(data stored in ACNUC7421 zone)

EMBL: CP000251.PE482

CP000251.PE482       Location/Qualifiers
FT   CDS_pept        complement(572788..574896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0484"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80260"
FT                   /db_xref="GOA:Q2IN77"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80260.1"
FT                   /translation="MSLNWKLARLVAALTLLPAPGAAEEPAAEPRTEVLLEEIVVKSRR
FT                   EPRADGLEVREVRETPARDLGEALEQALGVGKVRKAGIASDVVLRGLKRDDVNVLVDGT
FT                   RTHGACPSRMDPPAFHLDWAEVDGVEVRRGPFDVSQPGGLGGVVDVRTRGARPGPGAEV
FT                   NVGAGSFGAAESSAVASYGGGRASLLLGGAFKRSDPYLAGDGRNITEIIPATSTGRYRD
FT                   TSDHQTAYDVRSGWAKVGLVPAEGQQLELAYTRQEADDVLYPYLLMDGIRDDTDRVNAT
FT                   WRAGAIGPLASARAQLYWTRVAHDMDDRDRCSSAADPAACAGGLAEAWSMRTEARTRTL
FT                   GAKLEASLGGGDAALDARLGADLVVRNWDNETIRVRRAMPGQPYVGEASIPDVTQTTGG
FT                   VYAELRRALAPSLRATAGARLDVAESYAGVDRRDFYATWRPGSSPERSRTDLLLAGNVQ
FT                   LDWEAARGLTLFAGYGHGTRLPDPQERYMALAGLMGKPAWVGDPSLRPTRSDELDAGLR
FT                   FTADRLLAKAQVFHAWLADEITLVPLALPGGATAKTYAGVSARRVGGEASARLALPLRL
FT                   YAGAAVAYVWARNETAGTPLAEIPPLRASASLRWDDGRFFAEAEEQWAARQDRVDPALG
FT                   ERPTAAWFITNLRAGAEWRGLKAFVGVRNLLDKTYAEHLSYLRDPFAAGVKVPEPGRTL
FT                   YANVQYAF"
     atgtccctga actggaagct cgcgcggctc gtggccgcgc tgacgctcct gcccgcgccc        60
     ggcgcggcgg aggagcccgc ggcggagccg cgcaccgagg tgctgctgga ggagatcgtg       120
     gtcaagtcgc ggcgcgagcc gcgcgccgac gggctggagg tacgcgaggt gcgcgagacg       180
     ccggcccggg acctgggcga ggcgctggag caggcgctcg gcgtcggcaa ggtgcgcaag       240
     gccggcatcg cgagcgacgt ggtgctgcgc ggcctgaagc gcgacgacgt gaacgtgctg       300
     gtggacggca cgcgcacgca cggcgcctgc ccgtcgcgca tggacccgcc cgcgttccac       360
     ctcgactggg ccgaggtgga cggcgtggag gtgcggcgcg ggccgttcga cgtgagccag       420
     ccgggcgggc tcggcggcgt ggtggacgtg cgcacccgcg gcgcgcgccc ggggccgggc       480
     gcggaggtga acgtgggcgc gggctcgttc ggcgccgcgg agagcagcgc cgtcgcgtcc       540
     tacggcggcg ggcgcgcctc gctgctgctg ggcggcgcgt tcaagcggag cgacccctac       600
     ctggccggcg acgggcggaa catcaccgag atcatcccgg cgaccagcac cggccgctac       660
     cgggacacct cggaccacca gaccgcgtac gacgtccgga gcggctgggc caaggtgggt       720
     ctggtgccgg cggaggggca gcagctcgag ctcgcctaca cgcgccagga ggcggacgac       780
     gtcctgtacc cgtacctgct catggacggc atccgggacg acaccgaccg ggtgaacgcg       840
     acctggcgcg ccggcgcgat cgggccgctc gcctcggcgc gggcgcagct ctactggacg       900
     cgggtcgcgc acgacatgga cgaccgcgac cgctgcagct ccgcggcgga cccagccgcc       960
     tgcgccggcg ggctggccga ggcctggtcg atgcgcaccg aggcgcgcac ccgcacgctc      1020
     ggcgcgaagc tggaggcgag cctcggcggc ggtgacgcgg ccctcgacgc gaggctcggg      1080
     gccgacctcg tcgtccgcaa ctgggacaac gagaccatcc gcgtgcggcg cgccatgccc      1140
     ggccagccgt acgtcgggga ggcgtcgatc cccgacgtca cccagaccac cggcggcgtc      1200
     tacgccgagc tgcgccgcgc gctcgcgccg tcgctgcgcg ccaccgccgg cgcgcgcctc      1260
     gacgtggccg agtcgtacgc cggcgtggac cggcgagact tctacgccac ctggcggccg      1320
     ggctcgtcgc cggagcgctc ccgcaccgac ctgctcctcg ccggcaacgt ccagctcgac      1380
     tgggaggcgg cgcgcggcct gaccctgttc gcggggtacg gccacggcac gcgcctgccg      1440
     gacccgcagg agcgctacat ggcgctggcg gggctgatgg ggaagccggc ctgggtgggc      1500
     gatccgtcgc tccgcccgac gcgcagcgac gagctggacg cggggctgcg cttcaccgcc      1560
     gaccggctgc tcgcgaaggc gcaggtgttc cacgcctggc tcgccgacga gatcacgctg      1620
     gtgccgctgg cgctgccggg cggcgcgacc gccaagacct acgccggcgt cagcgcgcgc      1680
     cgggtgggcg gcgaggcctc ggcgcggctg gcgctgccgc tgcggctcta cgccggcgcg      1740
     gcggtcgcgt acgtgtgggc ccgcaacgag accgccggga cgccgctcgc cgagatcccg      1800
     ccgctgcgcg cgagcgcgtc gctgcggtgg gacgacggcc gcttcttcgc cgaggcggag      1860
     gagcagtggg cggcgcggca ggaccgggtg gacccggcgc tcggcgagcg gcccaccgcc      1920
     gcgtggttca tcacgaacct gcgcgcgggc gccgagtggc gcggcctgaa ggcgttcgtg      1980
     ggcgtgcgca acctgctcga caagacctat gccgagcacc tgtcctacct gcgggatccg      2040
     ttcgcggccg gcgtgaaggt gccggagccg gggcggacgc tgtacgccaa cgtccagtac      2100
     gcgttctag                                                              2109
//

If you have problems or comments...

PBIL Back to PBIL home page