(data stored in ACNUC7421 zone)

EMBL: CP000251.PE488

CP000251.PE488       Location/Qualifiers
FT   CDS_pept        583150..583986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80266"
FT                   /db_xref="GOA:Q2IN84"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80266.1"
FT                   /translation="MPSQPIIAQARQGPQAPAAAPAKRRSMLPHEHGAWGQLAMPLLTA
FT                   LAIARPGAAAWLLTAAVVLAFVAHEPLLVVLGQRGRRAVAEDGARARRWLAALGGLAAA
FT                   TGIAGIALAPPVARLALLLPAALAALVGVLVWRRLEKTVAGEITVAAALASAGYAVALA
FT                   AGAEHPAALAALLAWILAFGAATLAVQVILVRVRSKGAADPGRRHAVLAGLLAVAAVAL
FT                   SAAGLPGALALATLPTALFSIVVCLVRVSPKRLRELGWALVGSSAVTLVILVVGLR"
     gtgccgagcc agcccatcat tgcccaggcc cgccagggtc cccaggcccc cgccgccgcg        60
     ccggcgaagc gccgctcgat gctgccgcac gagcacggcg cctggggcca gctcgccatg       120
     ccgctcctca ccgcgctcgc catcgcccgg cccggcgccg ccgcctggct gctcaccgcc       180
     gcggtggtgc tcgcgttcgt ggcgcacgag ccgctgctgg tcgtgctcgg gcagcgcggc       240
     cgccgcgccg tcgccgagga cggggcgcgc gcccgccgct ggctcgccgc gctgggcggg       300
     ctggccgccg ccaccgggat cgccggcatc gcgctcgcgc cgcccgtggc gcgcctcgcg       360
     ctgctgctcc cggccgcgct cgcggcgctg gtgggcgtgc tggtgtggcg ccggctcgag       420
     aagaccgtcg ccggcgagat caccgtggcc gccgccctcg cctccgccgg ctacgcggtg       480
     gcgctcgccg ccggcgccga gcaccccgcc gcgctcgccg cgctgctcgc ctggatcctc       540
     gcgttcgggg ccgccacgct cgcggtgcag gtgatcctcg tccgcgtccg ctcgaagggc       600
     gccgccgatc cgggccgccg ccacgcggtg ctggcgggcc tgctcgcggt cgcggccgtg       660
     gcgctcagcg ccgcgggcct gcccggcgcg ctcgcgctcg ccacgctccc caccgcgctc       720
     ttctccatcg tggtgtgcct ggtgcgcgtc tcgccgaagc ggctgcgcga gctgggctgg       780
     gcgctggtgg gctcgtccgc ggtgacgctc gtcatcctgg tggtcgggct ccgttga          837
//

If you have problems or comments...

PBIL Back to PBIL home page