(data stored in ACNUC7421 zone)

EMBL: CP000251.PE489

CP000251.PE489       Location/Qualifiers
FT   CDS_pept        584027..584791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80267"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80267.1"
FT                   /translation="MIPPRPPLLALCCLALALAAPSDARARRGRSARAAAEGRVVLDGE
FT                   AAAVRWTDGDTFRLLSGPRAGQRARLAGVNTLETYGPVHRWGGWRPEALLAVARAAGPR
FT                   AAAGSWDCRSVRGRGGRDRYGRLLVECPELSRALVREGLATVFAMDGPAEPALLAAQRE
FT                   AQRAGAGMWAEGVPDVIVSSAHSAGEAGLGRRGAYDRLVDAHTGAATARPHARTYRACE
FT                   EVCAGEGRGRSCLVYVPYERRFRDRPPCLVRR"
     gtgatcccgc cgcgcccgcc gctcctcgcg ctctgctgcc tcgccctggc gctcgccgcg        60
     ccctccgacg cgcgcgcccg tcgcggccgg tccgcccgcg ccgccgccga ggggcgggtg       120
     gtgctcgacg gcgaggccgc cgcggtgcgc tggaccgacg gcgacacctt ccggctcctc       180
     tccggccctc gcgccggcca gcgcgcgcgc ctcgccggcg tgaacacgct cgagacctac       240
     ggcccggtgc accgctgggg cggctggcgg ccggaggcgc tgctcgcggt ggcgcgcgcc       300
     gccggcccac gcgccgcggc cgggagctgg gactgccgca gcgtgcgcgg gcgcggcggg       360
     cgcgaccgct acggccggct gctggtggag tgccccgagc tgtcgcgcgc gctggtgcgc       420
     gaggggctcg cgaccgtgtt cgcgatggac gggcccgccg agcccgcgct gctcgcggcg       480
     cagcgcgagg cgcagcgcgc cggcgccggc atgtgggccg agggcgtgcc ggacgtgatc       540
     gtctcgagcg cgcactcggc gggcgaggcc gggctggggc ggcgcggcgc atacgaccgg       600
     ctggtggacg cgcacaccgg cgcggccacg gcgcggccgc acgcgcggac gtaccgggcc       660
     tgcgaggagg tgtgcgcggg ggagggccgc gggcgctcgt gcctcgtcta cgtcccgtac       720
     gagcgccgct tccgcgatcg cccgccctgc ctcgtccgcc ggtga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page