(data stored in ACNUC7421 zone)

EMBL: CP000251.PE490

CP000251.PE490       Location/Qualifiers
FT   CDS_pept        584961..585395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0492"
FT                   /product="Hemerythrin-like, metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80268"
FT                   /db_xref="GOA:Q2IN86"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80268.1"
FT                   /translation="MIEAHAWNEKLDLGHEAMDHEHHLQIALVTALTEAIEQARPWMAR
FT                   QLSAQLLSYSGVHFGSEEMLMQASAFDGLADHASEHRTLLEAMREIQAALERGEDDLAL
FT                   AFAVELRAGLAGHMAGSDRRLADHVRPAHPAGAVVIPIRS"
     atgatcgaag cgcacgcctg gaacgagaag ctcgacctcg gccacgaggc gatggaccac        60
     gagcaccacc tgcagatcgc gctcgtgacc gcgctcaccg aggccatcga gcaggcgcgc       120
     ccctggatgg cccggcagct ctcggcccag ctcctctcgt acagcggcgt ccacttcggc       180
     agcgaggaga tgctcatgca ggcgagcgcg ttcgacgggc tcgccgatca cgcctcggag       240
     caccgcacgc tgctcgaggc catgcgcgag atccaggcgg cgctggagcg cggtgaggac       300
     gacctcgcgc tcgcgttcgc cgtcgagctc cgcgccggcc tggccggcca catggcgggc       360
     tccgaccgcc gcctcgccga tcacgtccgc cccgcgcatc cggcgggcgc cgtggtcatc       420
     ccgatccgct cgtag                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page