(data stored in ACNUC7421 zone)

EMBL: CP000251.PE491

CP000251.PE491       Location/Qualifiers
FT   CDS_pept        complement(585413..586201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0493"
FT                   /product="ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80269"
FT                   /db_xref="GOA:Q2IN85"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80269.1"
FT                   /translation="MEFEVDVRRMELRGRPVLRDVRFSVAAGERVVLLGVNGCGKTTLL
FT                   KLMDGLAFPQEGAVRWRGRPLEPAALAGAAFRRAFRGEVGLLFQNVDAMLFNPSVADEI
FT                   AFGPRQLGVPEAEVEARVARWAGAFGLTALQERPPFELSGGEKKRVAMAALMAVGPKVL
FT                   LLDEPTAGLDPASAGRLVDFLAGLEGTTVVTSTHHLTLAEELGTRAVLLGPDRPGVLHD
FT                   GPTGALVRDERALVESGLAHRHVHAHGAEVHAHFHVHDTE"
     gtggaattcg aggtggacgt ccggcggatg gagctgcgcg gccggccggt gctgcgcgac        60
     gtccggttct cggtggccgc gggcgagcgg gtggtgctgc tgggcgtgaa cggctgcggg       120
     aagaccacgc tcctcaagct catggacggg ctcgcgttcc cgcaggaggg cgcggtgcgc       180
     tggcgcggac gcccgctcga gccggcggcg ctcgccgggg cggcgttccg gcgcgcgttc       240
     cgcggcgagg tggggctcct gttccagaac gtggacgcga tgctgttcaa cccgtcggtc       300
     gccgacgaga tcgcgttcgg cccgcggcag ctcggcgtcc ccgaggccga ggtcgaggcg       360
     cgcgtggcgc gctgggccgg cgcgttcggc ctcacggcgc tgcaggagcg gccgccgttc       420
     gagctctccg gcggcgagaa gaagcgggtg gcgatggcgg cgctcatggc cgtcgggccg       480
     aaggtgctct tgctcgacga gcccaccgcc ggcctcgatc ccgccagcgc cgggcggctg       540
     gtggacttcc tggccgggct ggaggggacg accgtcgtca cctccacgca ccacctcacg       600
     ctggcggagg agctgggcac gcgggcggtg ctgctcgggc cggatcgccc cggcgtgctg       660
     cacgacgggc cgaccggcgc gctggtccgc gacgagcggg ccctggtgga gagcgggctc       720
     gcgcaccggc acgtgcacgc gcacggggcc gaggtgcacg cgcacttcca cgtgcacgac       780
     acggagtag                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page