(data stored in ACNUC7421 zone)

EMBL: CP000251.PE496

CP000251.PE496       Location/Qualifiers
FT   CDS_pept        588517..589374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0498"
FT                   /product="Carbohydrate kinase, PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80274"
FT                   /db_xref="GOA:Q2IN93"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80274.1"
FT                   /translation="MTPPARPPLRLAVVGHVEHVTIGRVPALPRAGEIAHLQAPRWFPG
FT                   GGGGVAFWQLARSPAEVLLFTALGGDEAGAQVERALAASGPRVRVHAARRAGPHTRDLV
FT                   LLTPDGERTIVVVGEPLHPRADDALPWGALAGCDAAYFTAQDPAALRAARAARLLVVTA
FT                   RRREALARSGVAADVVVGSRLDAREVSARADYPVPPGALVLTEGAAGGTIETAAGVERF
FT                   PAPPSPDGIGGAYGAGDSFAGALVYLLAAGLPLRDACAAAGRHGAAVLRAVDPRDGQLP
FT                   LEAP"
     atgacgccgc ccgcccgtcc cccgctccgg ctcgccgtgg tcggccacgt cgagcacgtc        60
     accatcggcc gcgtgccggc gctgccgcgc gccggcgaga tcgcgcacct ccaggcgccg       120
     cggtggttcc ccggcggcgg gggcggggtg gcgttctggc agctcgcccg ctcgccggcc       180
     gaggtcctgc tgttcaccgc gctcggcggc gacgaggccg gcgcgcaggt ggagcgggcg       240
     ctcgccgcga gcggaccgcg ggtgcgcgtg cacgccgctc gccgggccgg gccgcacacc       300
     cgcgacctcg tcctgctcac cccggacggc gagcgcacca tcgtggtggt cggcgagccg       360
     ctccacccgc gcgcggacga cgcgctgccc tggggcgcgc tggccggctg cgacgccgcg       420
     tacttcaccg cgcaggaccc cgccgcgctc cgcgccgccc gcgcggcgcg cctgctcgtg       480
     gtgaccgccc gccggcgcga ggcgctggcc cggtcgggcg tcgccgccga cgtggtggtg       540
     gggagccgcc tcgacgcgcg cgaggtgagc gcgcgcgccg actacccggt gccgcccggc       600
     gcgctggtgc tgaccgaggg cgccgctggc gggacgatcg agacagccgc cggggtggag       660
     cgcttcccgg cgccgccctc gcccgacggg atcggcggcg cgtacggcgc gggcgacagc       720
     ttcgccggcg cgctcgtgta cctcctcgcg gccgggctgc cgctccgcga cgcctgcgcg       780
     gcggcgggcc gccacggggc ggcggtgctg cgcgcggtgg acccgcgcga cggccagctt       840
     ccgctggagg cgccgtga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page