(data stored in ACNUC7421 zone)

EMBL: CP000251.PE5

CP000251.PE5         Location/Qualifiers
FT   CDS_pept        6733..7728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0005"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79783"
FT                   /db_xref="GOA:Q2ILV1"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79783.1"
FT                   /translation="MPRAAIVALGTHVPDRVVTNEELTRHMETTDAWIQERTGIQERRW
FT                   VREGTGNSDLALEATKKALDKAGWKPTDIEAIVYASLSPDHMFPGDGCFLNAKLGIPGV
FT                   PAIDIRNQCTGFLYGLSVADAWIRTGMYRRILLVGSEVHSTGLDVTTRGRDVAVIFGDG
FT                   AGAALLEATDDPGRGVLSCHLHADGRFARDLFTDAPGSIYHPRVQPRMLEDASIFPHME
FT                   GQKVFKHAVVRMPEVLKEAFDKNGVGPQDLKVLVPHQANLRIAQMVQRSLGLRDDQVFN
FT                   NIQRYGNTTAASIPLALAEAVEARGVVRGDLVGLCAFGAGFTWASALVRW"
     atgccccgcg ccgccatcgt cgcactcggc acgcacgtcc ccgaccgcgt ggtcaccaac        60
     gaggagctca cgcgccacat ggagaccacc gacgcgtgga tccaggagcg caccgggatc       120
     caggagcgcc gctgggtccg cgagggcacc ggcaactcgg acctcgcgct cgaggccacc       180
     aagaaggcgc tcgacaaggc cggctggaag ccgaccgaca tcgaggcgat cgtctacgcc       240
     tcgctctcgc ccgaccacat gttcccgggc gacggctgct tcctgaacgc gaagctcggc       300
     atccccggcg tgccggccat cgacatccgc aaccagtgca ccggcttcct ctacggcctc       360
     tcggtggcgg acgcctggat ccgcaccggc atgtaccggc gcatcctgct ggtcggctcg       420
     gaggtccact cgaccggcct cgacgtcacc acccgcggcc gcgacgtggc ggtgatcttc       480
     ggcgacggcg cgggcgcggc gctgctcgag gcgaccgacg acccgggccg cggcgtgctc       540
     tcctgccacc tgcacgcgga cggccgcttc gcgcgcgacc tgttcaccga cgcgcccggg       600
     tcgatctacc acccgcgcgt ccagccgcgg atgctcgagg acgccagcat cttcccgcac       660
     atggaggggc agaaggtctt caagcatgcg gtcgtgcgca tgcccgaggt gctgaaggag       720
     gcgttcgaca agaacggcgt gggcccgcag gacctgaagg tcctcgtccc gcaccaggcg       780
     aacctccgca tcgcgcagat ggtccagcgc tcgctcgggc tgcgcgacga ccaggtgttc       840
     aacaacatcc agcgctacgg caacaccacc gcggcctcca tcccgctcgc gctcgccgag       900
     gcggtcgagg cgcgcggcgt cgtccgcgga gacctggtgg gactgtgcgc cttcggggcc       960
     ggctttactt gggccagcgc cctggtacgc tggtga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page