(data stored in ACNUC7421 zone)

EMBL: CP000251.PE50

CP000251.PE50        Location/Qualifiers
FT   CDS_pept        61456..62460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0050"
FT                   /product="Beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79828"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79828.1"
FT                   /translation="MTEADLEGLGVHRIAIPVPFPQAGGPVNAYLVEDAGGGLLMFDAG
FT                   LGTPEAQAALEAGFARLGRRFDEVTRIVVSHGHVDHYGAARFVQERHGAPDLPVFGHPA
FT                   DAPKMSEQGPRWRELAPRLAAYLARQGVPPEVVELLAKQGEGGFRYARRLPEVRPIAEG
FT                   EVLRTRHLALEVVHMPGHTPGLLCLYEREKRLFFSDDHLLEKVSPNPLVELGPDGQDGF
FT                   FHPLLAYLDSLRRLRALEVDLVLPGHGPPFSGHREIIDALVGFYAKRQARMLELLRAGP
FT                   RTAHEIARALWPHARPADAFLTLSETVANLEVMESRGEVRRDRAAEPWRYLAA"
     gtgaccgagg cggatctcga agggctcggc gtccaccgca tcgccatccc ggtgccgttc        60
     ccgcaggcgg gcgggccggt caacgcctac ctggtcgagg acgccggcgg cggcctgctc       120
     atgttcgacg ccggcctggg cacgcccgag gcgcaggcgg cgctcgaggc cgggttcgcg       180
     cggctgggcc gccgcttcga cgaggtcacc cgcatcgtgg tctcgcacgg ccacgtggac       240
     cactacggcg ccgcgcgctt cgtgcaggag cggcacggcg ccccggacct cccggtgttc       300
     ggccacccgg ccgacgcgcc caagatgtcg gagcaggggc cgcgctggcg ggagctggcg       360
     ccgcggctcg ccgcgtacct ggcgcgccag ggcgtgccgc ccgaggtcgt cgagctgctc       420
     gcgaagcagg gcgagggcgg cttccgctac gcgcggcggc tccccgaggt gcggcccatc       480
     gccgaggggg aggtgctgcg cacgcgccac ctcgcgctcg aggtggtgca catgccgggg       540
     cacacgcccg ggctcctgtg cctgtacgag cgggagaagc gcctgttctt ctccgacgac       600
     cacctgctcg agaaggtctc gccgaacccg ctcgtcgagc tcgggccgga cggccaggac       660
     ggcttcttcc acccgctgct cgcctacctc gacagcctcc gccgcctgcg ggccctggag       720
     gtggacctgg tcctccccgg ccacggcccg ccgttctcgg gccaccgcga gatcatcgac       780
     gcgctcgtcg gcttctacgc gaagcggcag gcgcggatgc tcgagctgct ccgggccggg       840
     ccgcgcaccg cgcacgagat cgcccgcgcg ctctggcccc acgcccgccc cgccgacgcg       900
     ttcctcaccc tctccgagac ggtggcgaac ctggaggtga tggagtcgcg cggcgaggtg       960
     cggcgcgatc gcgcggccga gccctggcgc tacctcgccg cctga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page