(data stored in ACNUC7421 zone)

EMBL: CP000251.PE501

CP000251.PE501       Location/Qualifiers
FT   CDS_pept        592873..594117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0503"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80279"
FT                   /db_xref="GOA:Q2IN95"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IN95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80279.1"
FT                   /translation="MARALAPLLAGLLGLAGALGATLALHRAASAALDRVLEERLAGAG
FT                   ATAAELLGRAGADPAALRAVMAANGLEGAYVVDRDLRVLADATGAAGGRADLLRVDPAR
FT                   VARALRGEPSVAFAYAVGNLPVATGYFPVRGPDGAPAAALALEAGQGFAAARAGLRRAL
FT                   WLGVALSALAAVALALAAAGFARAERRSAAAAARAARGEALATMAAMVAHEIRNPLGVI
FT                   RGAAELVRARSGAALAPRDVEALGDVLGEVERLRRLTDDFLDLARDPAIAAEPADLAEL
FT                   AAEAARALGRAHPAVEVALSVPPLRVRADAARVRQVLANLLENAALAGARRVAVTAGPA
FT                   GPMARVEVRDDGPGVDADLRARLFEPFASGRARGAGLGLAISRRIAERHGGALELADPG
FT                   PPGAAFALTLPLEPG"
     atggcccgcg cgctcgcgcc gctgctcgcc ggcctgctgg gcctggccgg cgcgctcggc        60
     gcgacgctcg cgctccaccg cgccgcctcc gccgcgctgg accgcgtgct ggaggagcgg       120
     ctcgccggcg cgggcgccac cgccgccgag ctgctcgggc gcgccggcgc cgatccggcc       180
     gcgctgcgcg cggtcatggc ggcgaacggc ctggagggcg cctacgtggt ggatcgcgac       240
     ctccgcgtgc tggccgacgc caccggcgcg gccggcgggc gggccgacct gctccgggtg       300
     gacccggcgc gggtggcgcg cgcgctccgg ggcgagccgt cggtcgcgtt cgcctacgcg       360
     gtcgggaacc tcccggtggc caccggctac ttcccggtgc gcgggccgga cggcgcgccg       420
     gccgccgcgc tggcgctcga ggccgggcag ggcttcgccg ccgcgcgcgc cgggctgcgc       480
     cgggcgctgt ggctcggggt ggcgctctcg gcgctcgccg ccgtggcgct ggcgctggcc       540
     gcggccggct tcgcgcgggc ggagcgccgc tcggcggcgg cggcggcgcg ggccgcgcgc       600
     ggcgaggcgc tcgcgaccat ggccgccatg gtggcgcacg agatccgcaa cccgctcggc       660
     gtcatccgcg gcgcggccga gctggtgcgg gcccgctccg gcgccgcgct cgccccgcgc       720
     gacgtggagg cgctggggga cgtgctcggc gaggtggagc ggctgcggcg gctcaccgac       780
     gacttcctgg acctggcgcg cgatcccgcc atcgcggccg agccggccga cctcgccgag       840
     ctcgccgccg aggcggcgcg cgcgctgggc cgcgcccacc cggcggtcga ggtggcgctc       900
     tcggtgccgc cgctccgggt gcgcgccgac gcggcgcgcg tgcgccaggt gctcgcgaac       960
     ctgctcgaga acgcggcgct ggccggggcg cgccgggtgg cggtcaccgc cggccccgcc      1020
     ggacccatgg cgcgggtcga ggtgcgcgac gacgggccgg gggtggacgc ggacctgcgc      1080
     gcgcgcctgt tcgagccgtt cgcgagcggg cgggcccgcg gcgccggcct ggggctggcc      1140
     atctcccggc gcatcgccga gcggcacggc ggcgcgctcg agctcgccga cccgggccca      1200
     cccggcgcgg ccttcgcgct caccctgccg ctcgagcccg gatag                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page