(data stored in ACNUC7421 zone)

EMBL: CP000251.PE504

CP000251.PE504       Location/Qualifiers
FT   CDS_pept        complement(596861..598012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0506"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80282"
FT                   /db_xref="GOA:Q2INA0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80282.1"
FT                   /translation="MSDPNDHRPPPGGPGHLQEQGQLLRLLVDSVKEYAIFMLDPAGHV
FT                   LTWNPGAERIKGYPAHEIVGRHFAVFFTPEDVRRGKPDAELREAAEQGSSEDEGWRVRR
FT                   DGTRFFASVVVTALRGPDGALRGFAKITRDLTERRRGEEARRNLAEAREAVRSRDDFLA
FT                   VASHELRTPLTCVQLVTQSLARQTHEGQAVTGQQVERLEQLQRHVARLGELVSGLLDLA
FT                   EMSRGALQLEPAPFDLAELVHEVAARFEPDVRRRGTALSVHAPGPIPGRWDRRRVGDAI
FT                   AAVLGNAVKYGGRSPIEVTASRDDRRAVVVIEDRGPGIALEDQSRVFERFERAAPVAHY
FT                   PGLGVGLWTARQILNAHGGDIAVESAAGKGARFSLRLPLEYPA"
     atgagcgacc ccaacgacca tcgcccgccc ccgggcggcc cggggcacct gcaggagcag        60
     gggcagctcc tccgcctcct cgtggacagc gtgaaggagt acgcgatctt catgctggat       120
     ccggcgggcc acgtgctcac ctggaacccg ggcgcggagc ggatcaaggg gtacccggcg       180
     cacgagatcg tggggcggca cttcgcggtg ttcttcacgc ccgaggacgt ccgccgcggc       240
     aagccggacg cggagctgcg cgaggcggcc gagcagggct cgagcgagga cgagggctgg       300
     cgcgtacggc gcgacggcac gcgcttcttc gcgagcgtgg tggtcaccgc cctgcgcggc       360
     ccggacggcg cgctccgcgg gttcgcgaag atcacccgcg acctcaccga gcgccggcgc       420
     ggcgaggagg cgcggcggaa cctggccgag gcgcgcgagg cggtgcgctc gcgcgacgac       480
     ttcctggcgg tcgcgtccca cgagctgcgc accccgctca cctgcgtgca gctcgtgacc       540
     cagtcgctcg cccggcagac gcacgagggg caggcggtca cgggccagca ggtggagcgc       600
     ctcgagcagc tgcagcgcca cgtggcgcgg ctgggcgagc tggtgagcgg gctgctcgac       660
     ctcgccgaga tgtcgcgcgg cgcgctgcag ctcgagccgg ccccgttcga cctcgccgag       720
     ctggtgcacg aggtggcggc gcgcttcgag ccggacgtcc ggcgcagggg gacggcgctg       780
     agcgtgcacg cgcccgggcc gatccccggc cggtgggacc gccgccgggt gggcgacgcg       840
     atcgcggcgg tgctcggcaa cgcggtgaag tacggcgggc gctcgcccat cgaggtcacg       900
     gccagccgcg acgaccggcg ggcggtcgtg gtcatcgagg accgggggcc gggcatcgcg       960
     ctcgaggacc agtcgcgcgt gttcgagcgc ttcgagcggg cggcgccggt ggcgcactac      1020
     ccagggctcg gcgtgggcct gtggacggcc cggcagatcc tgaacgcgca cggcggagac      1080
     atcgcggtcg agagcgccgc gggcaagggc gcccggttct cgctccggct tccgctcgag      1140
     taccccgcct ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page