(data stored in ACNUC7421 zone)

EMBL: CP000251.PE513

CP000251.PE513       Location/Qualifiers
FT   CDS_pept        605277..605639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80291.1"
FT                   /translation="MTALRRAARWCLTALALAAAPAARAQGEPAADAPFPLTLEVGEVK
FT                   PLCPTGTVQCPPRAILCDDPKVAVGADSPEGGALRGVGPGTTTCSAAGGSPLGARRVYR
FT                   VTVVAPGDAARDAGAR"
     atgaccgcgc tccgccgtgc cgcccgctgg tgcctgaccg ccctcgcgct cgccgccgcg        60
     ccggccgcgc gcgcgcaggg cgagccggcc gccgacgcgc cgttcccgct cacgctggag       120
     gtgggcgagg tgaagccgct ctgccctacc ggcaccgtgc agtgcccgcc gcgcgcgatc       180
     ctctgcgacg atccgaaggt ggccgtgggc gcggactcgc cggagggcgg cgcgctccgc       240
     ggcgtcggcc cgggcaccac cacctgctcg gccgcgggcg gctcgccgct cggcgcgcgc       300
     cgcgtgtacc gggtgacggt ggtcgccccc ggcgacgcgg cgcgcgacgc cggcgcccgc       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page