(data stored in ACNUC7421 zone)

EMBL: CP000251.PE516

CP000251.PE516       Location/Qualifiers
FT   CDS_pept        complement(610385..611623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0518"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80294"
FT                   /db_xref="GOA:Q2INB3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80294.1"
FT                   /translation="MNPSLRSPRAATRRAPGLLFGNRALAPAALALALVAAGCGKKQEA
FT                   RAPGPVEVGVITLSPQAVTLTTELPGRVSAFKVAEVRARVNGIVLKRLFTEGSDVKQGQ
FT                   PLFKIDPAPYQAALDSARAQLARAEATLSSARLTAERYTELVAANAVSRQEHEDAVAAL
FT                   KKAEADVAAGRAAVDAARINLGYTTVTSPVGGRIGRSEVTEGAYVQAAQATLLATVQQL
FT                   DPVYVDVTQSSAELLRMRRDLEAGKLQSAGAGKAKVALTTEDGREYGLPGTLQFADVTV
FT                   DPGTGSVALRAIFPNPRAELLPGTYVRARLAEGVNPQALLVPQRAVARNNKGEPTALVV
FT                   AGGKVELRNLVTERVIGDAWLVTSGVKPGEQVIVEGLQKVRPGAPVNPVPAGGAKQANA
FT                   ATPGQPAPAGAAR"
     atgaacccct ccctccgctc ccctcgcgcc gccacgcggc gcgctcccgg cctccttttc        60
     ggcaaccgcg cgctcgcgcc cgccgcgctc gcgctcgcgc tcgtcgccgc cgggtgcggc       120
     aagaagcagg aggcgcgcgc ccccggcccg gtcgaggtcg gcgtgatcac cctctccccg       180
     caggcggtga cgctcaccac cgagctgccc ggtcgcgtct ccgcgttcaa ggtcgccgag       240
     gtccgcgccc gcgtgaacgg catcgtgctg aagcgcctgt tcaccgaggg cagcgacgtg       300
     aagcaggggc agccgctgtt caagatcgac ccggcgccct accaggccgc gctcgacagc       360
     gcccgggcgc agctcgcccg cgccgaggcg acgctctcgt cggccaggct caccgccgag       420
     cgctacaccg agctcgtggc cgcgaacgcg gtgagccggc aggagcacga ggacgccgtg       480
     gccgcgctga agaaggccga ggccgacgtc gccgccggcc gggccgcggt ggacgccgcc       540
     cgcatcaacc tcggctacac caccgtcacc tccccggtgg gcggccgcat cggccgctcc       600
     gaggtgaccg agggcgccta cgtgcaggcg gcgcaggcca cgctgctcgc caccgtgcag       660
     cagctcgacc cggtctacgt ggacgtgacg cagtccagcg ccgagctgct ccggatgcgc       720
     cgcgatctcg aggccggcaa gctccagtcc gccggcgccg gcaaggcgaa ggtcgcgctc       780
     accaccgagg acggccgcga gtacggcctc cccggcacgc tgcagttcgc cgacgtcacc       840
     gtggatcctg gcaccggctc ggtggcgctg cgcgcgatct tccccaaccc ccgcgccgag       900
     ctgctccccg gcacctacgt gcgggcccgc ctcgccgagg gcgtgaaccc gcaggcgctg       960
     ctcgtcccgc agcgcgccgt ggcccgcaac aacaagggtg agcccaccgc gctggtggtc      1020
     gccggcggca aggtcgagct gcgcaacctg gtcaccgagc gcgtgatcgg cgacgcgtgg      1080
     ctcgtgacct ccggcgtgaa gcccggcgag caggtgatcg tcgagggcct ccagaaagtg      1140
     cgccccggcg cccccgtcaa cccggtcccg gccggcggcg cgaagcaggc gaacgccgcg      1200
     accccgggcc agccggcccc ggcgggcgcg gcccgctga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page