(data stored in ACNUC7421 zone)

EMBL: CP000251.PE522

CP000251.PE522       Location/Qualifiers
FT   CDS_pept        616854..617321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0524"
FT                   /product="protein of unknown function DUF454"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80300"
FT                   /db_xref="GOA:Q2INC1"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80300.1"
FT                   /translation="MRPVRDPPYTSPVPPDPEPTTAATRAAPARRLLLLALGWTAFALG
FT                   AIGLLLPIVPTTPFMLVALWAFSASSERFHRWLYTHRLFGPPLQKWQRDRAIPVWVKAI
FT                   ALGSMAVSLAWLAFVVRPPRYALLAAAALVACGAAFVLRIPSRPRQPVREP"
     ttgcggccgg tgcgcgatcc gccctacacc tctcccgtgc cgcccgaccc cgagccgacg        60
     accgccgcga cccgcgccgc cccggcccgc cggctgctgc tcctcgcgct cggctggacg       120
     gcgttcgccc tgggcgcgat cgggctgctg ctccccatcg tgcccaccac gccgttcatg       180
     ctggtggcgc tctgggcgtt ctcggccagc tccgagcgct tccaccgctg gctgtacacg       240
     caccggctct tcgggccgcc gctgcagaag tggcagcggg atcgcgccat cccggtctgg       300
     gtgaaggcga tcgcgctcgg gagcatggcg gtgagcctcg cctggctggc gttcgtggtg       360
     cggccgccgc gctacgcgct cctcgccgcc gcggccctcg tcgcctgcgg cgccgcgttc       420
     gtcctgcgca tcccgagccg cccccggcag ccggtgcggg agccgtga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page