(data stored in ACNUC7421 zone)

EMBL: CP000251.PE530

CP000251.PE530       Location/Qualifiers
FT   CDS_pept        623280..624224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80308"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80308.1"
FT                   /translation="MTRDPAPGAWPELPLAQWEGTRHALHMCTQLIGKTLLACAPPLNH
FT                   WWHTALRVSAHGLASPVAIPTADGWLDLELDLVDHALVMRTGQRTASMPLVARSVHALH
FT                   DEYLALLDQLGVRIRLWPVPVEVPQPVPFDRDDAPRPYDAGAAHRFWQVLRGCAAALET
FT                   LCDGFVGKQSPVHFFWGSFDLAATRFSGRRAPERPGADAVNREAYSHEVISWGFWPGGA
FT                   SAAGVRVEEPVLYAYAAPEPPGFREADPGVAAASYDPRLGEFLLPYAVVRAAPDPAAVI
FT                   RAFCEATYRAGATLGGWDRAALERGPGRPAAAR"
     atgacccgag atcccgcgcc gggcgcctgg cccgagctgc cgctcgccca gtgggagggc        60
     acgcgccacg cgctgcacat gtgcacgcag ctcatcggca agaccctgct ggcctgcgca       120
     ccgccgctga accactggtg gcacaccgcg ctgcgggtct ccgcccacgg cctggccagc       180
     cccgtggcca tccccaccgc cgacggctgg ctcgacctcg agctcgacct cgtggaccac       240
     gcgctcgtga tgcgcaccgg ccagcgcacc gcgtcgatgc cgctcgtcgc acggtccgta       300
     cacgcgctcc acgacgagta cctcgccctg ctcgaccagc tgggcgtgcg catccgcctc       360
     tggccggtgc cggtcgaggt gccgcagccc gtcccgttcg accgggacga cgcgccgcga       420
     ccgtacgacg ccggggcggc gcaccggttc tggcaggtgc tccggggctg cgcggcggcg       480
     ctggagacgc tctgcgacgg gttcgtcggc aagcagagcc cggtgcactt cttctgggga       540
     agcttcgacc tcgccgcgac gcgcttctcc ggccgtcgcg cgccggagcg gccgggcgcg       600
     gacgccgtga accgcgaggc gtactcgcac gaggtgatct cgtggggctt ctggccgggc       660
     ggcgcgagcg cggccggcgt ccgcgtggag gagccggtgc tgtacgccta cgcggcgccg       720
     gagccgccgg gcttccgcga ggcggacccg ggggtcgcgg cggcgtcgta cgacccgcgc       780
     ctcggcgagt tcctgctccc ttacgcggtc gttcgcgccg cgccggatcc ggccgcggtg       840
     atccgcgcgt tctgcgaggc cacctaccgc gccggcgcga cgctgggcgg ctgggatcgc       900
     gccgcgctgg agcgcggccc cggccgcccc gccgccgccc ggtga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page