(data stored in ACNUC7421 zone)

EMBL: CP000251.PE533

CP000251.PE533       Location/Qualifiers
FT   CDS_pept        626814..627440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0535"
FT                   /product="outer membrane protein, OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80311"
FT                   /db_xref="GOA:Q2INC9"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80311.1"
FT                   /translation="MKRMLLVMALALAMAPVAEAQAPTPESGLMVRLRALYLRPADRSD
FT                   AIPALGVPENAITVSDKVIPEVDLSWFFNRYLAAELILTYPQQHDVELSGARIGTFSHL
FT                   PPTLTVQGHLPLGRVKPYLGAGVNFTLVTATDLAVPGVGKLELEDYSFGFAAQAGVDVQ
FT                   LAGPWYANADVKYVTIRSDVKAGGTKVSEVRVDPWLIGGGIGYRF"
     atgaagcgga tgctgctcgt gatggcgctc gcgctcgcga tggcgccggt ggcggaggcg        60
     caggcgccga ccccggagtc gggcctcatg gtccggctgc gcgcgctcta cctgcgcccg       120
     gccgaccggt ccgacgcgat ccccgcgctc ggggtcccgg agaacgcgat caccgtgagt       180
     gacaaggtca tcccggaggt cgatctctcc tggttcttca accggtacct cgcggccgag       240
     ctcatcctca cgtatccgca gcagcacgac gtggagctgt cgggcgcgag gatcggcacg       300
     ttcagccacc tgcccccgac gctcacggtt cagggccacc tgccgctcgg ccgggtgaag       360
     ccctacctcg gcgccggcgt gaacttcacg ctcgtcacgg ccaccgacct cgccgtgccc       420
     ggcgtgggca agctcgagct ggaggactac agcttcgggt tcgcggccca ggcgggggtg       480
     gacgtgcagc tggccgggcc ctggtacgcc aacgcggacg tgaagtacgt cacgatccgc       540
     tccgacgtga aggccggcgg cacgaaggtg agcgaggtcc gcgtcgatcc gtggctgatc       600
     ggcggcggca tcgggtaccg gttctag                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page