(data stored in ACNUC7421 zone)

EMBL: CP000251.PE535

CP000251.PE535       Location/Qualifiers
FT   CDS_pept        complement(628390..629133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80313"
FT                   /db_xref="GOA:Q2INC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80313.1"
FT                   /translation="MGVTGAPSWPAARRARGPLGEVDGRVVLLLALLFGVLVWRAGAAA
FT                   NAVYAAGFAAALAASGATAREARRLARWAGGFALLWGGVKLALDLAGGVPPAAALATAG
FT                   LLCLRLAALLLLGAAVSALVSPRALGLALATLTRPVLRDRAWSASLALLLMVHFVPRAL
FT                   AAFEAARAALRARRVRLSRTRALALVVEAGTRNLARMTWDQTLAVAARRLDRPEAWTGV
FT                   PPPRARDWCAGAAVAALAVAAAALL"
     atgggcgtga ccggcgcgcc gtcctggccc gccgcgcggc gggcgcgcgg tccgctcggc        60
     gaggtggacg gccgggtggt gctgctcctc gcgctcctgt tcggcgtgct ggtgtggcgc       120
     gccggcgccg cggccaacgc cgtctacgcg gccggcttcg cggcggcgct ggcggcctcc       180
     ggggcgaccg cgcgcgaggc gcgccggctg gcgcggtggg cgggcgggtt cgcgctgctg       240
     tggggcggcg tgaagctcgc gctcgacctc gccggcggcg tcccgcccgc ggccgcgctc       300
     gccaccgccg ggctcctgtg cctgcggctc gcggcgctgc tcctgctcgg cgcggcggtg       360
     agcgcgctcg tcagcccgcg cgcgctgggg ctcgcgctcg ccaccctgac gcggccggtg       420
     ctgcgcgatc gcgcctggag cgcctcgctc gcgctcctgc tcatggtgca cttcgtcccg       480
     cgcgcgctcg ccgcgttcga ggcggcgcgc gcggcgctgc gggcgcgccg ggtccggctg       540
     tcgaggaccc gcgcgctggc gctggtggtg gaggccggga cgcgcaacct cgcgcgcatg       600
     acctgggacc agacgctggc ggtggccgcg cgccggctgg accgccccga ggcgtggacc       660
     ggcgtgcccc cgccccgcgc ccgcgactgg tgcgccggcg cggcggtggc ggcgctcgcg       720
     gtcgcggcgg ccgcgctgct ctag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page