(data stored in ACNUC7421 zone)

EMBL: CP000251.PE536

CP000251.PE536       Location/Qualifiers
FT   CDS_pept        complement(629124..629852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0538"
FT                   /product="ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80314"
FT                   /db_xref="GOA:Q2IND5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IND5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80314.1"
FT                   /translation="MIRADGLGYAFGAGGPALEAIGFALPRGALCAVVGANGSGKSTLL
FT                   ALLAGLFTPSAGTLAVGGDASPGAEEAIRRRAALVLQDPDQQIIGATVDEDLLLGLRPG
FT                   DAAARDAARALAARLGLLDLSAPVHALSLGTRRKLCIATALRDAPEVLLLDEPFAGLDY
FT                   PAIREVRAVLAANRAAGVTQVVAAHDLEALADLADRWLVLERGRLVADGAAEAVFPLLR
FT                   GHGVRPPGAWLSAHGLDPWA"
     atgatccgcg cggacgggct cggctacgcg ttcggcgcgg gcggaccggc gctcgaggcg        60
     atcggcttcg cgctgccgcg cggcgcgctc tgcgcggtgg tcggcgcgaa cggctccggc       120
     aagtccacgc tgctcgcgct cctcgccggg ctgttcaccc cgagcgccgg gacgctcgcg       180
     gtgggcggcg acgcctcgcc cggcgcggag gaggccatcc gccggcgcgc ggcgctggtg       240
     ctccaggatc cggatcagca gatcatcggc gcgaccgtgg acgaggacct gctgctcggg       300
     ctgcggcccg gcgacgcggc ggcgcgcgac gcggcccggg cgctcgcggc gcggctcggc       360
     ctgctcgacc tctcggcgcc ggtccacgcg ctctcgctcg gcacgcgccg gaagctctgc       420
     atcgccaccg cgctccgcga cgcgcccgag gtgctgctgc tcgacgagcc gttcgccggg       480
     ctcgactacc cggccatccg cgaggtgcgc gcggtgctcg ccgcgaaccg ggccgcgggc       540
     gtcacgcagg tcgtggccgc gcacgacctc gaggcgctgg cggacctcgc cgatcgctgg       600
     ctggtgctgg agcgcggccg gctggtggcg gacggcgccg ccgaggcggt gttcccgctg       660
     ctgcgggggc acggggtccg gccgccgggc gcgtggctct cggcgcacgg gctcgaccca       720
     tgggcgtga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page