(data stored in ACNUC7421 zone)

EMBL: CP000251.PE537

CP000251.PE537       Location/Qualifiers
FT   CDS_pept        complement(629849..630430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0539"
FT                   /product="BioY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80315"
FT                   /db_xref="GOA:Q2IND4"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IND4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80315.1"
FT                   /translation="MPAPNADPAPPRPAPSPPLARVHRLVWTALLAACIAVGAWIQVPV
FT                   GAVPITLQPLFAFLAGYLLGPARGAAAVALYVAAGVLGLPVFAGGAAGLGVVLGPTGGY
FT                   LLGFVVAAALTGLVPRRGPIGWGAGLAAGAAALAAAYVIGAAWLAAVLHLGARQAIVAG
FT                   VVPFLPFDVVKVVVALWVARRLRAQGLAPA"
     atgcccgccc cgaacgccga tcccgccccg ccccgccccg cgccgtctcc cccgctcgcc        60
     cgcgtgcacc ggctggtctg gaccgcgctc ctcgccgcgt gcatcgcggt gggcgcctgg       120
     atccaggtgc cggtcggcgc cgtccccatc accctccagc cgctgttcgc gttcctggcc       180
     ggctacctgc tcggccccgc gcgcggcgcg gcggcggtgg cgctctacgt ggccgcgggc       240
     gtgctcggcc tcccggtgtt cgcgggcggc gccgccgggc tgggcgtggt gctcgggccg       300
     accggcggct acctgctcgg cttcgtcgtc gcggcggcgc tcaccggcct cgtcccccgg       360
     cgcgggccca tcgggtgggg cgccgggctc gccgccggcg cggcggcgct cgcggccgcg       420
     tacgtcatcg gcgcggcctg gctcgcggcg gtgctccacc tcggcgcgcg ccaggcgatc       480
     gtggccggcg tggtcccgtt cctgccgttc gacgtggtga aggtggtcgt ggcgctctgg       540
     gtggcccgcc gcctgcgcgc gcaggggctc gcgccggcat ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page