(data stored in ACNUC7421 zone)

EMBL: CP000251.PE539

CP000251.PE539       Location/Qualifiers
FT   CDS_pept        631211..632008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80317"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IND2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80317.1"
FT                   /translation="MRPRFRACITAALACAAALAPARGLAGPPYTTDDPEPVPFRHWEV
FT                   YLATADQWSHADGWGGTCPHLEVNYGAIPGVQLHLVAPLAWARPPGGPGRAGPGDTELG
FT                   AKWRFLDEGTRRPQVGVFPLVELPTGDDRRGLGAGRAQVFLPVWVQKSLGAWTTYGGGG
FT                   YWLSPGAGNRNWWLVGWQAQRRVADGVALGAEVFHSSAREIGGRGDTRFDVGAVLDLGA
FT                   LHHVLVSAGRALGSRAAQAYLAYQLTFGPGGGPEERAASGAPR"
     gtgcgccccc gcttccgcgc ctgcatcacc gcggcgctcg cctgcgccgc agcgctcgcg        60
     ccggcgcgcg gcctcgccgg cccgccgtac accaccgacg acccggagcc ggtgccgttc       120
     cggcactggg aggtctacct cgccaccgcc gaccagtggt cgcacgcgga cggctggggc       180
     ggcacctgcc cgcacctcga ggtgaactac ggcgcgatcc ccggcgtgca gctccacctg       240
     gtcgcgccgc tcgcctgggc ccggccgccg ggcgggccgg gccgcgcagg gcccggcgac       300
     accgagctgg gcgccaagtg gcggttcctg gacgagggca cgcggcggcc gcaggtgggc       360
     gtgttcccgc tcgtcgagct gcccaccggc gacgaccgtc gcgggctcgg cgccgggcgc       420
     gcgcaggtgt tcctgccggt gtgggtgcag aagagcctgg gcgcgtggac cacctacggc       480
     ggcggcgggt actggctgag ccccggggcg gggaaccgga actggtggct cgtcgggtgg       540
     caggcgcagc gccgcgtcgc cgacggcgtg gcgctcggcg cggaggtgtt ccactcgagc       600
     gcgcgcgaga tcggcgggcg cggcgacacg cggttcgacg tcggcgcggt gctcgacctc       660
     ggcgcgctgc accacgtgct cgtctcggcc ggccgcgcgc tcggctcgcg cgccgcccag       720
     gcctacctcg cgtaccagct caccttcggc cccggcggcg ggccggagga gcgcgctgcc       780
     tccggcgcgc cgcgctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page