(data stored in ACNUC7421 zone)

EMBL: CP000251.PE545

CP000251.PE545       Location/Qualifiers
FT   CDS_pept        complement(636103..636684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0547"
FT                   /product="FMN-binding pyridoxamine 5'-phosphate
FT                   oxidase-related protein protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80323"
FT                   /db_xref="GOA:Q2INE3"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80323.1"
FT                   /translation="MGHRFAELAFTPAVRAVQESMGSRAAYARMEAGPDHHDALGPDEA
FT                   GFIAARDSFYLASVGETGWPYLQHRGGPPGFVRVLGPRTIGFADYRGNRQYVTVGNLAR
FT                   NDRVALFFMDYPARTRLKLLGHARWVGPEEPALLAALSAPAGAAPVERGIVIEVAAFDW
FT                   NCSQHITPRFTEAELEAGAGPDQPWVPAAK"
     atgggacacc gattcgccga gctcgccttc acgcccgcgg tccgcgcggt gcaggagtcg        60
     atggggagcc gggccgcgta cgcgcggatg gaggccggcc ccgaccacca cgacgcgctc       120
     ggtccggacg aggccggctt catcgccgcg cgcgacagct tctacctcgc gagcgtgggc       180
     gagaccggct ggccgtacct gcagcaccgc ggcgggccgc ccgggttcgt gcgcgtgctc       240
     gggccgcgga cgatcgggtt cgccgactac cgcggcaacc gccagtacgt caccgtgggc       300
     aacctcgcgc ggaacgaccg cgtggcgctg ttcttcatgg actacccggc gcgaacgcgg       360
     ctgaagctgc tcggccacgc gcggtgggtc gggccggagg agccggcgct gctcgcggcg       420
     ctctcggcgc ccgccggcgc ggcgccggtc gagcgcggga tcgtgatcga ggtggcggcc       480
     ttcgactgga actgcagcca gcacatcacg ccgcgcttca ccgaggccga gctcgaggcc       540
     ggggccgggc ccgatcagcc gtgggtgccc gcggcgaagt ag                          582
//

If you have problems or comments...

PBIL Back to PBIL home page