(data stored in ACNUC7421 zone)

EMBL: CP000251.PE548

CP000251.PE548       Location/Qualifiers
FT   CDS_pept        complement(638843..639313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80326"
FT                   /db_xref="GOA:Q2INE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80326.1"
FT                   /translation="MDRSPERRTAVMIWGALVAGPALFLVVALALPLAGEPAPGIAQPL
FT                   LLVLTGLVLVEVPLSWLWAVRARLAGKAGGEAISVEEQARTRLIIAAALCEGAALFAVV
FT                   VFMVTRDARALPLFAIAFGALLAHYPGDRHWARLCRGSGAGSSAPPNRLMRG"
     atggaccgtt cgccggagcg tcgtacggcg gtgatgatct ggggcgcgct cgtcgcgggg        60
     ccggcgctgt tcctggtggt ggcgctcgcg ctgccgctcg ccggcgagcc ggccccgggc       120
     atcgcccagc cgctgctcct cgtgctcacc gggctggtgc tggtggaggt gccgctgtcc       180
     tggctctggg ccgtccgggc gcgcctggcc gggaaggcgg gcggcgaggc catctccgtc       240
     gaggagcagg cgcgcacccg gctcatcatc gccgccgcgc tgtgcgaggg cgccgcgctg       300
     ttcgcggtgg tggtgttcat ggtgacgcgc gatgcgcgcg cgctgccgct gttcgcgatc       360
     gcgttcgggg cgctcctcgc gcactacccg ggcgaccgcc actgggcgag gctctgccgc       420
     gggagcggcg ccggctcgag cgcgccgccg aaccgcctca tgcgcggcta g                471
//

If you have problems or comments...

PBIL Back to PBIL home page