(data stored in ACNUC7421 zone)

EMBL: CP000251.PE553

CP000251.PE553       Location/Qualifiers
FT   CDS_pept        complement(644323..644745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80331"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80331.1"
FT                   /translation="MSRARWKVVLVLALVFLAGGVSGAVVSRAVVQRAVGRLLEGPPEQ
FT                   ARASAILFRLDRDLDLTREQRGELRAVLARHRGELAAIRRTVAPQLEAARRRQWAEMRE
FT                   VLDERQRDGFDRFVEELERRVARSLAAPPSAAAPIE"
     gtgagccgcg cccgctggaa ggtggtgctc gtcctggcgc tcgtgttcct cgccggcggc        60
     gtgagcggcg cggtggtgtc tcgcgccgtg gtccagcgcg cggtggggcg gctgctcgag       120
     ggtccgccgg agcaagcccg cgccagcgcg atcctgttcc ggctggaccg ggacctggac       180
     ctcacgcgcg agcagcgggg cgagctccgc gcggtgctcg cgcgccaccg cggcgagctc       240
     gccgcgatcc ggcgcaccgt ggcgccgcag ctcgaggcgg cgcggcgaag gcaatgggcc       300
     gagatgcgcg aggttctcga cgagcggcag cgcgacggct tcgaccggtt cgtcgaggag       360
     ctcgagcggc gcgtggcccg atcgctcgcg gcgccgccgt ccgcggccgc tccgatcgag       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page