(data stored in ACNUC7421 zone)

EMBL: CP000251.PE554

CP000251.PE554       Location/Qualifiers
FT   CDS_pept        complement(644742..645023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80332"
FT                   /db_xref="GOA:Q2INF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80332.1"
FT                   /translation="MRDHDESDDARLARLRDATGALHPSAAVVARLEAAVAARLRSPPA
FT                   WMAIAGGARPIALGAAALTAAMLLLGWRADRTFEEQVSRAAYVLEVLP"
     atgcgtgacc acgacgagag cgacgacgcc cgcctcgccc ggctccggga cgccaccggg        60
     gcgctccatc cctccgcggc ggtcgtcgcg cggctggagg cggcggtcgc cgcccgcctg       120
     cggagcccgc ccgcctggat ggccatcgcc ggcggggcgc ggccgatcgc gctcggcgcg       180
     gcggcgctca ccgcggcgat gctgctcctc ggctggcgcg ccgaccggac gttcgaggag       240
     caggtctcgc gcgccgccta cgtcctggag gtgctgccgt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page