(data stored in ACNUC7421 zone)

EMBL: CP000251.PE559

CP000251.PE559       Location/Qualifiers
FT   CDS_pept        649314..649886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0561"
FT                   /product="protein of unknown function DUF1211"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80337"
FT                   /db_xref="GOA:Q2INF3"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80337.1"
FT                   /translation="MNKGRLEAFSDGVLAIIITIMVLELKVPPGDTLEALAAMRSTFLG
FT                   YVLSFVYVGIYWNNHHHLMHTVHHVTGSIMWANLHLLFWLSLVPAVTAWADHYPSSPLP
FT                   TALYGVVLLAAALAWLVLQRAIIRAGGSLRLMIGADLKGKLSPILYLIAIALSFVRTWA
FT                   ADAVYALVAALWFIPDRRIERRSGAGE"
     atgaacaagg gccgcctcga ggcgttcagc gacggcgtcc tcgcgatcat catcacgatc        60
     atggtcctcg agctgaaggt gccgcccggc gatacgctcg aggcgctcgc ggccatgcgc       120
     tcgacgttcc tcggctacgt gctgagcttc gtgtacgtcg gcatctactg gaacaaccat       180
     caccacctga tgcacaccgt ccaccacgtg acgggcagca tcatgtgggc caacctccac       240
     ctgctgttct ggctgtcgct cgtccccgcg gtcacggcgt gggccgatca ctacccctcg       300
     tcgcccttgc cgacggcgct ctacggcgtc gtcctgctcg cggcggcgct ggcgtggctc       360
     gtcctccagc gcgccatcat ccgcgccggc ggctccctcc ggctgatgat cggggcggac       420
     ctgaagggca agctgtcgcc gatcctctac ctgatcgcga tcgcgctctc gttcgtccgc       480
     acctgggccg ccgacgccgt ctacgcgctc gtcgccgcgc tctggttcat ccccgaccgc       540
     aggatcgagc ggaggtcggg ggcgggggag tag                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page