(data stored in ACNUC7421 zone)

EMBL: CP000251.PE56

CP000251.PE56        Location/Qualifiers
FT   CDS_pept        68315..69334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0056"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79834"
FT                   /db_xref="GOA:Q2IM03"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79834.1"
FT                   /translation="MIQLTVSADAAGQRLDKLVRKALRDVPLSHVYKMFRTRKVRVNGA
FT                   RGKADQVVAEGDVVVIRGDEERLLAKAAPAAPGGAPRVTFGVLHEDADLLAVDKPAGLA
FT                   AHPGTGIEGATLVEMARGYLKTPDDLPPTEFKPSPAHRLDRDTSGVVLVAKHRKAMVRL
FT                   GETFTTGEGVHKTYLALVKGKMPREAGTIDLPLSEHEQTSKSKAMRGVNFQEALTRWKV
FT                   VSAAKEISLLAVTIETGRTHQIRRHLEAVGHPVAGDRRYGDFAFNRTARTRWGLRRMGL
FT                   HAWRLEVPHPLTGAPLRLEAPFPAELAEVLSRANLKLPASPTGAHAPGARREGPHRER"
     gtgatccagc tcaccgtctc ggccgacgcg gccggccagc gcctcgacaa gctcgtgcgc        60
     aaggcgctgc gcgacgtccc gctcagccac gtctacaaga tgttccgcac gcgcaaggtg       120
     cgggtgaacg gcgcgcgcgg caaggccgac caggtcgtcg ccgagggcga cgtggtggtg       180
     atccgcggcg acgaggagcg gctgctcgcg aaggcggcgc cggccgcgcc gggcggcgcg       240
     ccgcgggtga cgttcggcgt gctgcacgag gacgccgacc tgctcgcggt ggacaagccg       300
     gccggcctgg ccgcgcaccc cggcaccggg atcgagggcg cgacgctggt ggagatggcg       360
     cgcggctacc tgaagacgcc ggacgacctc ccgcccaccg agttcaagcc gtcgccggcg       420
     caccggctcg accgcgacac ctcgggcgtg gtgctggtcg cgaagcaccg gaaggcgatg       480
     gtgcggctcg gcgagacctt caccaccggc gaaggcgtcc acaagaccta cctcgcgctc       540
     gtgaagggga agatgccgcg cgaggcgggc accatcgacc tgccgctctc cgagcacgag       600
     cagacgtcga agtcgaaggc catgcgcggc gtgaacttcc aggaggcgct gacgcgctgg       660
     aaggtggtct cggccgcgaa ggagatctcg ctcctcgcgg tcaccatcga gaccggccgc       720
     acgcaccaga tccgccgcca cctcgaggcg gtgggccacc cggtggcggg cgaccggcgc       780
     tacggcgact tcgccttcaa ccgcaccgcg cgcacgcgct gggggctgcg ccgcatgggc       840
     ctgcacgcgt ggcggctgga ggtcccacat ccgctcaccg gcgcgccgct ccggctcgag       900
     gcgccgttcc cggcggagct cgcggaggtg ctctcccgcg cgaacctgaa gctccccgcg       960
     tcgcccaccg gcgcacacgc gcccggcgcg cgccgcgagg gaccgcaccg cgagcgttga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page