(data stored in ACNUC7421 zone)

EMBL: CP000251.PE560

CP000251.PE560       Location/Qualifiers
FT   CDS_pept        complement(649902..650633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0562"
FT                   /product="DNA mismatch repair protein MutS-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80338"
FT                   /db_xref="GOA:Q2INF6"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80338.1"
FT                   /translation="MRGWLTALGEMEALAALATRVYENPAEQFPEVVSTGTMLDAQELG
FT                   HPLLPVERCVRNDVRLGGTAPQLILLSGSNMSGKSTLLRALGASAALALAGGTVRARRM
FT                   VLSPVALCASLRVQDSVLDGASRFQAEVLRLCDVARFAAGPHAVLFLLDEILGGTNSDD
FT                   RLRGAKGVLTALVNRGAIGVCTTHDLALTRIADELGARATNAHLVDALVGGKLAFDYRL
FT                   RPGVVRRSNAIEWMRLVGLEV"
     gtgcgcggct ggttgaccgc gctcggggag atggaggcgc tcgccgcgct cgcgacccgc        60
     gtctacgaga acccggcgga gcagttcccc gaggtggtct ctaccggcac gatgctcgac       120
     gcgcaggagc tgggtcatcc gctcctcccc gtcgagcggt gcgtgcggaa cgacgtgcgg       180
     ctcggcggaa cggcgccgca actgatcctg ctctcgggct cgaacatgtc ggggaagtcg       240
     acgctgctcc gcgccctggg cgcgagcgct gcgctcgcgc tcgcaggcgg cacggtgcgg       300
     gcgcgccgga tggtgctctc cccggtggct ctctgcgcgt cgctccgggt ccaggattcg       360
     gtcctcgacg gcgcgtcccg cttccaggcg gaagtgctca gactctgcga cgtggcgcgc       420
     ttcgcagcgg gcccgcacgc ggtgctcttc ctgctcgacg agatcctggg cggcacgaac       480
     tccgacgatc gccttcgggg cgcgaagggc gtcctgaccg ctctcgtcaa tcgcggcgcg       540
     atcggggtct gcaccacgca cgacctcgcg ctgacgcgca tcgccgacga actcggcgcc       600
     agggcaacga acgcacacct cgtggacgca ctcgtgggcg gaaagctcgc gttcgactac       660
     cgcctccggc ccggcgtcgt gcggcgctcg aacgccatcg agtggatgcg gctcgtgggg       720
     ctcgaggtgt ag                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page