(data stored in ACNUC7421 zone)

EMBL: CP000251.PE561

CP000251.PE561       Location/Qualifiers
FT   CDS_pept        complement(651423..652646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0563"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80339"
FT                   /db_xref="GOA:Q2ING0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80339.1"
FT                   /translation="MISVLVVDDDRLKTTLIRQALRELATDIRVTGASNIVDALKLLRA
FT                   ESFDLLIVDLNVPMRKGESARPDGGVQLVELLRRGRGPLPAHIVALTEYDDLASQHQKA
FT                   FSGDLIYVVRFDRSSRAWSEAIGRKLLAIERSQAPRERGGYDYDLAVVTALTRVELEAV
FT                   LELPISWRRRNVPEDDTIYHEGCLKRAEGDLRVIAAAAPEMGMPATTALAMKMICGFRP
FT                   RYIAMVGIAAGLKGGFGDVLIADISWDYGSGKFKERPDGKGGVFEPGPTQLRLDARVRA
FT                   RLEDFSRDQTVAQRILHRWNGDPVPRQIEVAIGPVASGAAVVDSHEMIEQIRAQQRKVV
FT                   GVEMETYGVFMAARNAPEPKPIALSFKSVSDFGSQKGDDYQRFAAFTSAQFLYEFACSG
FT                   LEWPHSRS"
     gtgatttccg ttctcgttgt ggacgacgat cggctcaaga cgacgctaat ccggcaagcg        60
     ctgcgggaat tggcgaccga cattagagtt accggcgcca gcaacatcgt agacgcgctg       120
     aagcttcttc gtgcggagtc tttcgacctc ctgatcgtcg acctaaacgt cccgatgcga       180
     aaaggcgaga gcgctcggcc ggacgggggc gtccaacttg tcgaattgct acgccgtgga       240
     cggggcccgc ttccggccca cattgtcgcc ctcacggagt acgacgacct agcttcgcag       300
     catcagaaag cgttcagcgg cgaccttata tacgtcgtcc ggtttgatcg ttcctctcgt       360
     gcttggtcag aggcgatcgg tcgcaaactt ctggctatcg aacgctccca ggccccacgg       420
     gagcgggggg ggtacgatta tgacctagcg gtggtcaccg cccttacccg agtagagctt       480
     gaggccgtgc ttgaactccc gatcagctgg cggcgcagaa acgtccccga ggacgatact       540
     atttatcatg aaggatgtct gaaacgcgca gaaggcgacc tccgcgtcat cgctgcagcc       600
     gctcccgaaa tgggcatgcc ggccaccacc gcgctagcaa tgaagatgat ctgcggattt       660
     cggccgagat acatcgcgat ggtcggcatt gctgcaggac ttaagggtgg tttcggagat       720
     gtactgattg cagatatttc atgggactac gggagcggta agttcaaaga gcgccccgat       780
     ggcaagggcg gagtgttcga acccggcccg acgcaacttc gtcttgacgc gcgtgttcgc       840
     gcgcgcctgg aggacttcag ccgagaccag accgtcgcac aacgcattct ccatcgctgg       900
     aacggagatc ccgtcccccg acagattgag gtggccatcg gccccgtggc gtcgggcgct       960
     gcagttgttg actcgcacga gatgattgaa cagattcgtg cacaacagcg caaggttgta      1020
     ggtgtcgaga tggagactta cggcgtattt atggccgccc ggaacgcgcc cgagccgaag      1080
     ccgatcgcac tctcattcaa gtctgtatct gactttggat cacagaaagg tgacgactac      1140
     cagcgttttg ctgcctttac gagcgctcag ttcttgtacg agtttgcttg cagcgggcta      1200
     gagtggccac actcacggtc ctaa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page