(data stored in ACNUC7421 zone)

EMBL: CP000251.PE562

CP000251.PE562       Location/Qualifiers
FT   CDS_pept        complement(652643..653056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0564"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80340"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80340.1"
FT                   /translation="MRFLRTEFPTASVTAAQSYQSGLKAALGDTFDAIILDMSLPTYDI
FT                   SASNSGGRTRGYGGREFLEALKRRRRNTKVVVVTQFDTFGEGADAMNLTQLTEQLRAEY
FT                   PDIYVGTAFYQASQTAWRDELQAYLKSVSGDLS"
     atgcgctttc tgcgcactga gtttccgacc gcctccgtga ctgctgctca gtcataccaa        60
     agcggcctca aggcagcgct cggcgacacg tttgacgcca tcatcttgga catgtcactt       120
     cccacgtacg acatttcagc atcgaacagc ggcggccgca cgcgcggata cggaggccgt       180
     gagttccttg aggcgctaaa gcgccgaagg cggaacacca aagtcgtcgt cgtcacccag       240
     ttcgacacct ttggtgaagg cgctgacgcg atgaacctga cgcagctgac ggagcaactt       300
     cgcgccgagt acccggacat ctacgtcggc actgcgttct atcaagcgtc ccagacggct       360
     tggcgcgacg agcttcaggc ctatctgaag tctgtctcgg gagacctctc gtga             414
//

If you have problems or comments...

PBIL Back to PBIL home page