(data stored in ACNUC7421 zone)

EMBL: CP000251.PE565

CP000251.PE565       Location/Qualifiers
FT   CDS_pept        657850..660546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0567"
FT                   /product="RNA polymerase associated protein rapA"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80343"
FT                   /db_xref="GOA:Q2ING2"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80343.1"
FT                   /translation="MAWKAGMKVVHRAQRAWGVGVVVQVADEGRRLAVRFAGREGITVV
FT                   SGRDQALVEVPADTPIEQVASGPIEALASAQPATASAFALRTRVNRLEALRRADSLGAL
FT                   LSSRVHVLPHQVGAAGRILSDRMPRFVLADEVGLGKTVEAGLVFAGMRQLGLAERVLVV
FT                   VPEHLAFQWLAELFHKFNALFALLTPERIEALGGPEAALARSPHAIVSFEALRADPELA
FT                   EAAADLPLDLVVVDEAHHLADDALHDRVAPICRASFGVLLLTATPVRLDPREYFRLLSL
FT                   VEPVPSTSLDDFLARLEQHEAYAQVARDLLAGGDLAAAAERLRALAPDDLVFSKAPPAL
FT                   DRGALLAHLAERYGLSSRLIRNRRVKVGAFTSRALRRVDVGEGEKPKALVDLCARLARA
FT                   GDKVLVFGGDLEALRGLQGGLAEAGLEALLYDDAPSLEARDRLVARFRDPEGPMLLLSG
FT                   ESGGEGRNFQFAHHLVCADLPASPLVLEQRIGRLDRLGQTRPVEIHVPVEPGDEAFLAD
FT                   LYEQEIGIFDEPVGGLDAVLASLPDELAALARKRSDRTREAFRKDLAKRVAAARKAQHE
FT                   GDPLLDIRSASLPELARLVRGAFERMGEEAPDGIDGGDGAGSALEQSLITLSRWLEEEL
FT                   EDVCADVGRRVGMDVDTDQNVQPFEVAFTLGSGMRIEALPGMQIPDEPETFVGSFWRET
FT                   AVARDELHWYATGHKLVEALLGLVRDGDAGRSAAVKREWAPRRGGLYARFEPRLATAAD
FT                   VAPGARVASRQASRYLDLSPIAVVVDLEAGNRVLPGAAHRLEDEIDDVQDARVGAPPPA
FT                   ALEAARAAAEREARLVMERRREEAVGLLLAHADAEEERLIEAAFAGGAPRERIDGALAV
FT                   LRHHRDVVAKSIERVKLDLDAAALIVP"
     atggcctgga aagcagggat gaaggtggtc caccgcgccc agcgggcgtg gggcgtcggg        60
     gtggtggtgc aggtggcgga cgagggccgc cgcctggcgg tccggttcgc gggccgggag       120
     gggatcacgg tcgtctcggg ccgcgatcag gccctggtcg aggtcccggc ggacacgccc       180
     atcgagcagg tggcctccgg gccgatcgag gcgctcgcct ccgcccagcc cgccacggcc       240
     tcggcgttcg cgctccgcac ccgcgtcaac cgcctggagg cgctgcgccg cgcggactcg       300
     ctgggcgcgc tcctctcctc ccgcgtccac gtcctgccgc accaggtggg cgcggcgggg       360
     cgcatcctct ccgaccggat gccgcgcttc gtcctggcgg acgaggtggg cctgggcaag       420
     acggtcgagg cgggcctggt gttcgcgggg atgcggcagc tggggctggc cgagcgcgtc       480
     ctggtggtgg tcccggagca cctcgccttc cagtggctgg ccgagctctt ccacaagttc       540
     aacgcgctgt tcgcgctcct caccccggag cggatcgagg cgctgggggg cccggaggcg       600
     gcgctcgccc gctcgccgca cgccatcgtc tccttcgagg cgctccgcgc cgacccggag       660
     ctggcggagg ccgccgccga cctgccgctc gacctcgtgg tcgtggacga ggcgcaccac       720
     ctggccgacg acgcgctgca cgatcgggtt gcgccgatct gccgcgcctc cttcggcgtg       780
     ctgctcctca ccgcgacccc ggtccgcctg gatccgcgcg agtactttcg cctgctctcg       840
     ctggtcgagc cggtcccctc cacctcgctc gacgacttcc tcgcgcgcct ggagcagcac       900
     gaggcctacg cgcaggtggc ccgcgacctg ctcgccggcg gcgacctcgc cgcggcggcg       960
     gagcggctcc gcgcgctggc cccggacgac ctggtgttct cgaaggcgcc gccggcgctc      1020
     gaccgcggtg cgctgctcgc gcacctcgcc gagcggtacg ggctctcctc ccggctcatc      1080
     cgcaaccgcc gcgtgaaggt gggcgcgttc acctcgcgcg cgctccgccg cgtggacgtg      1140
     ggggagggcg agaagccgaa ggcgctggtg gacctctgcg cgaggctggc gcgggcgggc      1200
     gacaaggtgc tcgtgttcgg cggcgacctc gaggcgctgc gcgggctcca gggcgggctc      1260
     gccgaggccg ggctggaggc gctcctctac gacgacgcgc cctcgctcga ggcgcgcgac      1320
     cggctggtgg cccgcttccg cgacccggag ggcccgatgc tgctcctctc cggcgagtcg      1380
     ggcggcgagg ggcgcaactt ccagttcgcg caccacctgg tctgcgccga cctgccggct      1440
     tcgccgctcg tcctcgagca gcgcatcggc cggctcgacc gcctgggcca gacgcgcccg      1500
     gtggagatcc acgtgccggt ggagccgggc gacgaggcgt tcctggccga cctctacgag      1560
     caggagatcg gcatcttcga cgagccggtg ggcggcctcg acgcggtgct ggcctcgctg      1620
     ccggacgagc tggcggcgct cgcgcgcaag cgctcggacc gcacccgcga ggcgttccgg      1680
     aaggacctcg ccaagcgcgt ggccgccgct cgcaaggcgc agcacgaggg cgacccgctc      1740
     ctcgacatcc gctccgcctc gctgccggag ctggcgcgcc tggtgcgcgg cgcgttcgag      1800
     cgcatgggcg aggaggcgcc ggacgggatc gacggcggcg acggcgcggg gagcgcgctg      1860
     gagcagtcgc tcatcacgct ctcgcgctgg ctggaggagg agctggagga cgtctgcgcc      1920
     gacgtggggc gccgggtcgg catggacgtg gacaccgacc agaacgtcca gccgttcgag      1980
     gtcgccttca cgctcggctc gggcatgcgc atcgaggcgc tgccggggat gcagatcccc      2040
     gacgagccgg agacgttcgt ggggagcttc tggcgcgaga cggcggtcgc ccgcgacgag      2100
     ctgcactggt acgcaaccgg ccacaagctg gtcgaggcgc tgctggggct ggtgcgcgac      2160
     ggcgacgcgg ggcggagcgc ggcggtgaag cgcgagtggg cgccgcgccg gggcggcctg      2220
     tacgcgcgct tcgagccgcg cctcgccacc gccgccgacg tggcgccggg cgcgcgggtc      2280
     gcctcgcggc aggcctcgcg ctacctcgac ctctcgccca tcgcggtggt ggtggacctg      2340
     gaggcgggga accgggtgct gcccggcgcg gcgcaccggc tcgaggacga gatcgacgac      2400
     gtgcaggacg cgcgggtcgg cgcgccgccg ccggccgcgc tggaggcggc ccgcgcggcg      2460
     gcggagcgcg aggcgcggct ggtgatggag cgtcgccgcg aggaggcggt gggcctgctc      2520
     ctcgcgcacg ccgacgccga ggaggagcgg ctcatcgagg ccgcgttcgc cggcggcgcg      2580
     ccgcgcgagc ggatcgacgg ggcgctggcg gtgctgcgcc accaccgcga cgtggtggcg      2640
     aagtccatcg agcgggtgaa gctcgacctc gacgcggcgg cgctgatcgt tccctga         2697
//

If you have problems or comments...

PBIL Back to PBIL home page