(data stored in ACNUC7421 zone)

EMBL: CP000251.PE569

CP000251.PE569       Location/Qualifiers
FT   CDS_pept        664217..666085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0571"
FT                   /product="putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80347"
FT                   /db_xref="GOA:Q2ING6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80347.1"
FT                   /translation="MANGRILVVDDERFFQELFRDVLAGAGHAVRTSSSAEEALEVLAA
FT                   ERVDLLLTDMVMPGLDGLGLIREARRRDPELEVVAVTGREDVKLAVESMKAGCSDFLTK
FT                   PLEPGELLRVAERVLARVRLRREHSQLLTENLEFVKAQALYRQGLQILATLDGERLVDL
FT                   ALSVLARTTDAQGAALWVADEKGQLALRGYRGLVDRAALPVRVDPRDPAFADALRGGAP
FT                   FQAPEGWGGEAFLVPLVADDEPLGLALLSDRARGRFGRDEHAAALMVADFAAIAVKNAR
FT                   RFQAVERVGLRDRETGAYNLSYFVDYAGKEFYKARRYGRAFSLVVLSVDNVEQLRKEAG
FT                   REPFRRLMRDLVAAVGRAVRDADILAKVSESEYYVLLPETDYFGALMFVRRATEEVRRE
FT                   ASVRTMEERVPVLLSIGAGSFPKDGEDFDELLHWARDRVQDQRGSLLRRLHLGDLEPGA
FT                   FWELTDVLLSGSARLPDSSASARLQPDPELFAAAQREAAREIARDPRARGLLYVGLRSA
FT                   LAASPVRAALPAGDPAARAGDPSARVYLLGPRGTDVEAAPHPLVTEVYVDGDQRFAGHE
FT                   FLLFLSERSAYALLSGPDGRTFHTSDMPLVDALVSKLQTAYDLQPI"
     atggcgaacg ggcggatcct ggtcgtggac gacgagcgct tcttccagga gctgttccgc        60
     gacgtgctgg ccggcgccgg gcacgcggtc cgcacctcgt cctcggcgga ggaggcgctg       120
     gaggtgctcg ccgccgagcg cgtggacctg ctgctcaccg acatggtgat gccgggcctg       180
     gacggcctgg ggctcatccg cgaggcgcgg cggcgcgacc cggagctcga ggtggtcgcg       240
     gtcaccggcc gcgaggacgt gaagctcgcg gtcgagtcga tgaaggccgg ctgctcggac       300
     ttcctcacga agccgctcga gcccggcgag ctgctccggg tggcggagcg ggtgctggcg       360
     cgcgtgcggc tccgccgcga gcacagccag ctcctcaccg agaacctcga gttcgtgaag       420
     gcccaggcgc tctaccgcca gggcctgcag atcctcgcca cgctggacgg cgagcggctg       480
     gtggacctgg cgctctcggt gctggcgcgc accaccgacg cgcagggcgc ggcgctgtgg       540
     gtggccgacg agaaggggca gctcgcgctg cgcggctacc ggggcctggt ggaccgggcg       600
     gcgctgccgg tccgggtgga cccgcgcgac cccgcgttcg ccgacgcgct gcgcggcggc       660
     gcgccgttcc aggcgccgga gggctggggc ggcgaggcgt tcctggtgcc gctcgtggcc       720
     gacgacgagc cgctcggcct ggcgctgctc tccgaccgcg cccgcgggcg cttcggccgc       780
     gacgagcacg cggccgcgct catggtggcc gacttcgccg ccatcgcggt gaagaacgcg       840
     cgccgcttcc aggcggtgga gcgggtgggg ctgcgcgacc gcgagaccgg cgcgtacaac       900
     ctctcctact tcgtggacta cgccggcaag gagttctaca aggcgcgccg ctacggccgg       960
     gcgttctcgc tggtggtgct ctcggtggac aacgtcgagc agctccgcaa ggaggcgggg      1020
     cgcgagccgt tccggcggct gatgcgcgac ctggtggccg cggtggggcg cgcggtccgc      1080
     gacgccgaca tcctcgcgaa ggtctcggag agcgagtact acgtgctgct ccccgagacc      1140
     gactacttcg gcgcgctcat gttcgtgcgc cgcgccaccg aggaggtccg gcgcgaggcg      1200
     tcggtccgga ccatggagga gcgcgtgccg gtgctcctct cgatcggcgc cggcagcttc      1260
     ccgaaggacg gggaggactt cgacgagctg ctgcactggg cgcgcgaccg cgtgcaggac      1320
     cagcgcggct cgctcctgcg ccgcctccac ctcggcgacc tcgagccggg cgcgttctgg      1380
     gagctgaccg acgtgctgct ctccggctcg gcgcgcctgc cggacagctc ggccagcgcg      1440
     cggctgcagc ccgaccccga gctgttcgcg gccgcgcagc gcgaggcggc ccgcgagatc      1500
     gcgcgcgacc cgcgcgcccg gggcctgctc tacgtgggcc tgcgctccgc gctcgccgcc      1560
     tcgccggtcc gggcggccct gcccgccggc gatccggccg cgcgcgccgg cgatccctcc      1620
     gcccgcgtct acctgctcgg cccgcgcggc accgacgtcg aggcggcgcc gcacccgctc      1680
     gtcaccgagg tgtacgtgga cggcgaccag cgcttcgccg ggcacgagtt cctgctgttc      1740
     ctctccgagc gctccgccta cgcgctgctc tccggtccgg atggccggac gttccacacc      1800
     tccgacatgc cgctggtgga tgcgctggtc tcgaagctgc agaccgcgta cgacctccag      1860
     ccgatctag                                                              1869
//

If you have problems or comments...

PBIL Back to PBIL home page