(data stored in ACNUC7421 zone)

EMBL: CP000251.PE57

CP000251.PE57        Location/Qualifiers
FT   CDS_pept        69371..71929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0057"
FT                   /product="Penicillin-binding protein 1A"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79835"
FT                   /db_xref="GOA:Q2IM02"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79835.1"
FT                   /translation="MSEPGEPHKPPEEPSSRVVLDGLPPERPLRRRLLRWGLFAGIAAV
FT                   NAAVVAAVVGWFVFSRGLPDVPTLEQYRPPIITEMISADGQIAGEFFVERRKVVPYARI
FT                   PKRVIQAFIASEDKNFFEHGGIDLLGTLRAAVKTYVLRSRIQGASTLTQQTAKALLISA
FT                   EGFERGTERSLRRKIRELILARRLEARFTKEQILWIYLNGVYLGHHSYGVQSAAENYYR
FT                   KNVEDLTLEEAALIAGLPQAPSRYSPFSRPEAAAERRRYVLRRMAEEGMITEAERRSAE
FT                   KAEVKVFGVDDVFRETAPFYVETVRRQVVDRYGNERLLHDGLRVEMAMDLEKQRAAQAA
FT                   VLKGLVEVDQRQGYTGPVAKVAGAERTALAARLAKAWPKGTLRPGDHCVGIVDRVDDKA
FT                   GVVEVEVGETRGVLPISGMRWARRPNPVVSYADALLSRPSSALHAGDVVVLKRVERAEL
FT                   QKKEAQLGVGRPKDVPEAPVLFSLQQDPTLQGALVAVDPGTAYVTAMVGGYDFEASEFN
FT                   RAFQACRQPGSAFKPVVYSAAVEKLDYTPATILTDAPIVFRDDESSWKPQNYGEDFKGD
FT                   VTLRTALVNSMNIPAVKTAEALNAKLGPAGLGDWAKTLGITTPVKQELGSALGSSCVTP
FT                   WELTNVYALFARYGEKRPSTFVKRVLDRDGRVLEDHADYRDPWVGLDERLAGAVAEVTR
FT                   PREQVMDPRSAYILVRLMREVATVGTGARAAALGKPAAGKTGTTNDSFDTWFMGFTRDL
FT                   ATGVWLGYDVNVTPLGRYETGGHAALPIWLDFMSAALKGRAQPEFEAPSGIVEVRIDPA
FT                   SGKAVADGAGGVPEPFKQGTEPVLADAEKKQVEVQDLFMQ"
     atgagcgagc ccggcgaacc ccacaagccg cccgaggagc cctcctcgcg cgtggtcctc        60
     gacgggctgc cgcccgagcg cccgctgcgc cggcggctcc tccgctgggg gctgttcgcc       120
     gggatcgcgg cggtgaacgc cgcggtcgtg gccgcggtgg tgggctggtt cgtgttctcg       180
     cgcggcctgc cggacgtccc cacgctggag cagtaccgcc cgcccatcat caccgagatg       240
     atctcggccg acggtcagat cgcgggcgag ttcttcgtgg agcgccgcaa ggtcgtcccc       300
     tacgcgcgca tcccgaagcg tgtcatccag gcgttcatcg cctcggagga caagaacttc       360
     ttcgagcacg gcggcatcga cctgctcggc acgctccgcg ccgcggtgaa gacctacgtg       420
     ctccgctcgc gcatccaggg cgcgtccacg ctcacgcagc agaccgccaa ggcgctcctc       480
     atcagcgccg aggggttcga gcgcggcacc gagcgcagcc tgcgccgcaa gatccgcgag       540
     ctgatcctgg cgcggcgcct cgaggcgcgg ttcacgaagg agcagatcct ctggatctac       600
     ctgaacggcg tgtacctcgg gcaccacagc tacggggtgc agtcggccgc ggagaactac       660
     taccggaaga acgtcgagga cctgacgctg gaggaggcgg cgctcatcgc cgggctgccg       720
     caggcgccct cgcgctactc gccgttctcg cggcccgagg cggccgcgga gcggcggcgc       780
     tacgtgctgc gccgcatggc cgaggagggg atgatcaccg aggccgagcg gcgcagcgcc       840
     gagaaggccg aggtgaaggt cttcggcgtg gacgacgtgt tccgcgagac cgcgccgttc       900
     tacgtggaga cggtgcggcg gcaggtggtg gaccgctacg gcaacgagcg gctgctgcac       960
     gacgggctgc gggtcgagat ggcgatggac ctcgagaagc agcgcgccgc gcaggcggcg      1020
     gtgctgaagg ggctcgtcga ggtggaccag cggcagggct acaccgggcc ggtcgcgaag      1080
     gtggccggcg cggagcggac cgcgctcgcc gcgcggctcg cgaaggcctg gccgaagggc      1140
     acgctgcggc ccggcgacca ctgcgtcggc atcgtggacc gggtggacga caaggcgggc      1200
     gtcgtcgagg tggaggtggg cgagacgcgc ggcgtgctgc ccatctccgg catgcgctgg      1260
     gcgcgccggc cgaacccggt ggtgtcctac gccgacgcgc tcctctcccg gccgtcgagc      1320
     gcgctccacg ccggcgacgt ggtggtgctg aagcgcgtcg agcgcgccga gctgcagaag      1380
     aaggaggcgc agctcggggt gggccggccg aaggacgtgc ccgaggcccc ggtgctgttc      1440
     tcgctccagc aggaccccac gctgcagggg gcgctggtcg cggtcgatcc cgggacggcg      1500
     tacgtcaccg ccatggtggg cggctacgac ttcgaggcgt ccgagttcaa ccgcgcgttc      1560
     caggcctgcc gccagccggg ctcggcgttc aagccggtcg tctactcggc cgcggtggag      1620
     aagctcgact acacgccggc gacgatcctc accgacgcgc ccatcgtgtt ccgcgacgac      1680
     gagtcgagct ggaagccgca gaactacggc gaggacttca agggcgacgt caccctgcgc      1740
     accgcgctcg tcaactcgat gaacatcccg gcggtgaaga ccgccgaggc gctcaacgcg      1800
     aagctcgggc cggcgggcct gggcgactgg gcgaagacgc tcgggatcac cacgccggtg      1860
     aagcaggagc tggggagcgc gctcggctcg tcctgcgtga cgccgtggga gctcaccaac      1920
     gtgtacgcgc tgttcgcgcg gtacggcgag aagcgcccca gcacgttcgt gaagcgggtg      1980
     ctggaccggg acgggcgcgt gctcgaggac cacgccgact accgcgaccc gtgggtcggg      2040
     ctcgacgagc ggctggcggg cgcggtggcc gaggtgacgc gcccgcgcga gcaggtgatg      2100
     gacccgcgca gcgcctacat cctggtgcgg ctgatgcgcg aggtggcgac ggtcggcacc      2160
     ggcgcgcgcg ccgcggcgct cgggaagccg gcggcgggca agaccggcac caccaacgac      2220
     tcgttcgaca cctggttcat ggggttcacc cgcgacctcg ccaccggcgt gtggctcggc      2280
     tacgacgtga acgtcacgcc gctcggccgc tacgagaccg gcggccacgc cgcgctgccc      2340
     atctggctcg acttcatgtc ggcggcgctg aagggccggg cccagcccga gttcgaggcg      2400
     ccgtcgggga tcgtcgaggt gcggatcgac ccggccagcg gcaaggccgt ggcggacggc      2460
     gccggcggcg tgcccgagcc gttcaagcag gggaccgagc ccgtgctcgc cgacgccgag      2520
     aagaagcagg tcgaggtgca ggacctgttc atgcagtag                             2559
//

If you have problems or comments...

PBIL Back to PBIL home page