(data stored in ACNUC7421 zone)

EMBL: CP000251.PE571

CP000251.PE571       Location/Qualifiers
FT   CDS_pept        667574..668374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0573"
FT                   /product="Phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80349"
FT                   /db_xref="GOA:Q2ING4"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80349.1"
FT                   /translation="MRIPIWQVDAFVTDGVFTGNPAAVCPLDAWLPDATLLAIAAENAL
FT                   SETAFLVAEGEGWHLRWFTPEVEVELCGHATLASAHVVFEHLARGRDAIAFRTQAGTLT
FT                   VTRDAAGRIALSLPRRPPAPADAPPALVRALGGRAPEATLLGRDYLAVLATEQEVRELR
FT                   PDLAAVSELPGHGIVVTAPASTPGVDFVSRYFAPQVGIPEDPVTGSAHCTLVPYWADRL
FT                   GRRTLEALQVSRRGGRLSCEDQPDAGKVRLAGRAAEFLSGSIEA"
     atgcgcatcc cgatctggca ggtggacgcg ttcgtcaccg acggcgtctt caccggcaac        60
     cccgccgcgg tctgtcccct cgacgcctgg ctgcccgacg ccacgctgct cgccatcgcg       120
     gccgagaacg cgctctccga gaccgcgttc ctggtcgccg agggcgaggg ctggcacctg       180
     cgctggttca cgcccgaggt cgaggtcgag ctgtgcgggc acgccacgct cgcctcggcg       240
     cacgtggtgt tcgagcacct ggcccgcggg cgcgacgcga tcgcgttccg cacgcaggcc       300
     ggcacgctca ccgtcacccg cgacgccgcg ggccggatcg cgctgtcgct gccccgccgg       360
     ccgcccgcgc cggccgacgc gccgcccgcg ctcgtgcggg cgctcggcgg ccgcgcgccg       420
     gaggcgacgc tgctcggccg cgactacctg gccgtgctcg cgacggagca ggaggtccgc       480
     gagctccggc cggacctcgc cgcggtgtcg gagctgcccg gccacggcat cgtcgtcacc       540
     gcgcccgcga gcacgcccgg ggtggacttc gtctcgcgct acttcgcccc gcaggtcggg       600
     atccccgagg acccggtcac cggctcggcg cactgcacgc tggtgcccta ctgggcagat       660
     cggctcggcc ggcggacgct ggaggcgctg caggtgtccc gccgcggggg ccggctctcc       720
     tgcgaggacc agccggacgc gggcaaggtc cgcctcgccg gccgcgcggc cgagttcctg       780
     tccggctcca tcgaggcctg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page