(data stored in ACNUC7421 zone)

EMBL: CP000251.PE573

CP000251.PE573       Location/Qualifiers
FT   CDS_pept        complement(668818..669252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0575"
FT                   /product="Hemerythrin-like, metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80351"
FT                   /db_xref="GOA:Q2INH0"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80351.1"
FT                   /translation="MALHWTSVLSIGVPELDAEHEEMFTRMDRLHDAILSGERAEVSRM
FT                   IEYLREHAVRHLAAEETLMLAIGYPDRERHLREHEAFLATVRELTRRHDANGPTAVLVH
FT                   DVERAVASWIDGHVGIHDVALGAFAREHLRRRQGGERRPA"
     atggcgctgc actggacgag cgtgctgtcg atcggcgtcc ccgagctgga cgccgagcac        60
     gaggagatgt tcacgcggat ggatcggctg cacgacgcga tcctctcggg cgagcgcgcg       120
     gaggtctcgc gcatgatcga gtacctccgc gagcatgcgg tccggcacct ggcggccgag       180
     gagacgctga tgctcgcgat cggctacccg gatcgcgagc ggcacctgcg cgagcacgag       240
     gcgttcctcg ccaccgtccg cgagctcacg cgccgccacg acgcgaacgg cccgacggcg       300
     gtgctggtgc acgacgtgga gcgcgcggtg gcgagctgga tcgacggcca cgtcgggatc       360
     cacgacgtgg cgctcggggc gttcgcgcgc gagcacctgc ggcgccgcca gggcggcgag       420
     cgcaggcccg cctag                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page