(data stored in ACNUC7421 zone)

EMBL: CP000251.PE576

CP000251.PE576       Location/Qualifiers
FT   CDS_pept        672547..673416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0578"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80354"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80354.1"
FT                   /translation="MTGLALVVALVGIAIAVLSYRSASAARAALAARTAEDVKRGEELE
FT                   AARKAERAARAEAKERRDEATAVKAELERSKKKAFEQQEAAKKAGGAQALRVELDKLAA
FT                   RLAEARAEAEHQTTRARALEKELEKAAAAVKRLEARPAVAAAPAPAPVAPVPQAAAPAA
FT                   PAVDDGRLAAEKDRADKAEAKLAEARKRVADLEKDVKNVRGRLETEKRVYIVQKSELEL
FT                   AGDRYAELRRRHEALRKDHDELVEAVRQAAREERRLTQQEAARAEAATPPAAPEGEGEG
FT                   DAGGSSAA"
     atgaccggcc tcgccctcgt cgtcgccctc gtcggcatcg ccatcgccgt gctctcctac        60
     cgcagcgcca gcgccgccag ggccgcgctg gccgcgcgca ccgcggagga cgtgaagcgc       120
     ggggaggagc tggaggccgc ccgcaaggcg gagcgcgccg cccgcgccga ggcgaaggag       180
     cgccgcgacg aggccaccgc cgtgaaggcg gagctggagc gcagcaagaa gaaggcgttc       240
     gagcagcagg aggcggcgaa gaaggccggc ggcgcccagg cgctccgcgt cgagctcgac       300
     aagctcgccg cccggctcgc cgaggcccgc gcagaggccg agcaccagac cacccgcgcg       360
     cgcgcgctgg agaaggagct cgagaaggcc gccgccgcgg tgaagcggct ggaggcccgg       420
     ccggccgtgg ccgccgcgcc cgcgcccgcg ccggtcgcgc ccgtgccgca ggccgccgcc       480
     cccgccgcgc cggccgtgga cgacggccgc ctcgccgcgg agaaggaccg ggccgacaag       540
     gcggaggcga agctggccga ggcgcgcaag cgggtcgccg acctggagaa ggacgtgaag       600
     aacgtccgcg gccggctcga gaccgagaag cgcgtctaca tcgtccagaa gagcgagctc       660
     gagctcgccg gcgaccggta cgccgagctg cgccgccgcc acgaggcgct gcgcaaggat       720
     cacgacgagc tggtcgaggc cgtgcgccag gccgcccgcg aggagcggcg cctcacgcag       780
     caggaggccg cccgcgccga ggcggcgacc ccgcccgccg cgccggaggg cgagggcgag       840
     ggcgacgccg gcgggtcgag cgcggcctga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page