(data stored in ACNUC7421 zone)

EMBL: CP000251.PE579

CP000251.PE579       Location/Qualifiers
FT   CDS_pept        675285..676388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0581"
FT                   /product="transcriptional regulator-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80357"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80357.1"
FT                   /translation="MSAAGSKRRPAGARAKVSSKAPARAKPGAKPAAKPVRGPARAPSR
FT                   AAAGAPAAPKKADPRDRLRRVLFLVPYAVRHPGIPVRDLARRCGCTEKELLEDLDFLLE
FT                   VGSPPFAPDDFLDLYVEGDRVYVALHQSFSRPPRFTESEAAALAAAAAALGGEGRERAV
FT                   KALRDSVPRDRRASFDELVERIYAGAPPARDSVLGRLQRAIAERRAVRLAYHSASRDAE
FT                   TDRTVRPYTLAQRFGHWYLYGHDAERGKALAFRLDRIRECTLLPDRFEPPTEAELARAR
FT                   LFSEAAGEPVRIRLGAEAAPWALSRPGISLVERTPGGGAVVEVAGAGNDWATRFALSLG
FT                   GGAEVVAPAAARRAFAETVRRTLARYA"
     gtgagcgccg ccggatcgaa gcgccgtccc gccggggcgc gggcgaaggt ctcctcgaag        60
     gcgccggcca gggcgaagcc gggcgcgaag ccggccgcga agccggtccg cggtcccgct       120
     cgcgcaccgt cccgcgccgc cgccggcgcg cccgccgcgc cgaagaaggc cgacccgcgc       180
     gaccgcctcc gccgcgtgct gttcctggtg ccgtacgcgg tccgccaccc cggcatcccg       240
     gtgcgcgacc tggcgcggcg ctgcggctgc accgagaagg agctgctcga ggacctcgac       300
     ttcctgctcg aggtgggctc gcccccgttc gcgccggacg acttcctcga cctgtacgtc       360
     gagggcgacc gcgtctacgt ggcgctgcac cagagcttct cgcgcccgcc gcggttcacc       420
     gagagcgagg ccgccgcgct cgccgcggcc gcggcggcgc tgggcggcga ggggcgcgag       480
     cgcgcggtga aggcgctccg cgactcggtc ccgcgcgacc ggcgcgccag cttcgacgag       540
     ctggtggagc gcatctacgc cggcgccccg ccggcgcgcg actcggtgct gggccggctc       600
     cagcgcgcca tcgccgagcg gcgcgcggtg cgcctcgcct accactccgc gtcgcgcgac       660
     gccgagaccg accggaccgt gcgcccgtac acgctcgcgc agcgcttcgg ccactggtac       720
     ctgtacggcc acgacgccga gcgcgggaag gcgctcgcct tccgcctgga ccggatccgc       780
     gagtgcacgc tgctcccgga ccgcttcgag ccgcccaccg aggccgagct ggccagggcc       840
     cggctgttct ccgaggcggc cggcgagccg gtgcggatcc ggctcggcgc ggaagcggcc       900
     ccgtgggcgc tctcgcgccc cggcatctcg ctggtggagc ggacgccggg cggcggggcg       960
     gtggtggagg tggccggcgc cgggaacgac tgggccacgc ggttcgcgct ctcgctgggc      1020
     ggcggggccg aggtggtcgc gccggccgcc gcgcggcggg cgttcgccga gacggtccga      1080
     cgcacgctgg cgcggtacgc ctga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page