(data stored in ACNUC7421 zone)

EMBL: CP000251.PE583

CP000251.PE583       Location/Qualifiers
FT   CDS_pept        complement(679223..680257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80361"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80361.1"
FT                   /translation="MRRPPLVLAAALLAGSTGCVAHMPRSDEPTMLLERSYVGASTASG
FT                   QSFEAAPAFHVLLHNGLDDPEVFDHGGWASALSASFLATLRVSRGDSAPVRTPTYEPRA
FT                   KLQLFRLDPAGARPAPSAPRPWMRMAVLELGGGHRSNGQRGCSLDEHVRRPGDGDWECA
FT                   AATDPPSTALNLDDGSFTTNYVAGGAYLRLLRTGDQPGAFTSAVTVGGGLEYEVACALG
FT                   ACMPQGMRRRFGPVNARYLAEWEALVLRGRTRRLPLFGTVHLDSSVRATLSGNVHLGAA
FT                   RGPFGDLSAEVAILPRNPKGMVMGLFVRRHLGYDYLNIRFEERLDAWLFGLVLDPTPLD
FT                   GARR"
     atgcgccgcc cccccctcgt cctcgcagcc gcgctgctcg ccgggagcac cggctgcgtc        60
     gcccacatgc cccgctccga cgagcccacc atgctgctcg agcgcagcta cgtgggcgcg       120
     tccaccgcga gcggccagtc cttcgaggcg gcgcccgcct tccacgtcct gctgcacaac       180
     gggctcgacg acccggaggt cttcgaccac ggcggctggg cgagcgcgct ctccgcctcg       240
     ttcctggcca cgctgcgggt gtcgcgcggc gactcggcgc cggtgcgcac gccgacctac       300
     gagccgcgcg cgaagctgca gctcttccgg ctcgatccgg ccggcgcgcg cccggcgccc       360
     tcggcccccc ggccctggat gcggatggcg gtgctggagc tgggcggcgg ccaccgctcc       420
     aacgggcagc gcgggtgctc gctcgacgag cacgtgcgcc gccccggcga cggagactgg       480
     gagtgcgccg ccgccaccga cccgccctcc accgcgctca acctcgacga cgggagcttc       540
     accacgaact acgtcgccgg cggcgcctac ctgcgcctgc tacgcaccgg cgatcagccc       600
     ggcgcgttca cctccgcggt cacggtcggc ggcggcctcg agtacgaggt cgcctgcgcc       660
     ctgggcgcgt gcatgccgca gggcatgcgc cgccgcttcg ggccggtgaa cgcccggtac       720
     ctggccgagt gggaggcgct ggtgctgcgc gggcgcacgc ggcggctgcc gctcttcggc       780
     accgtccacc tggacagcag cgtgcgggcc acgctctccg gcaacgtgca cctgggcgcc       840
     gcgcgcggcc cgttcggcga cctgtcggcg gaggtcgcca tcctgccccg caacccgaag       900
     ggcatggtga tgggcctctt cgtgcggcgc cacctcgggt acgactacct caacattcgc       960
     ttcgaggagc ggctcgacgc gtggctgttc ggcctggtgc tcgacccgac gccgctggac      1020
     ggcgcgcggc gctga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page