(data stored in ACNUC7421 zone)

EMBL: CP000251.PE588

CP000251.PE588       Location/Qualifiers
FT   CDS_pept        complement(685748..687745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0590"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80366"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80366.1"
FT                   /translation="MRFRTALAAAAIALSAACSGSSGSSGPSGGPPPAPLTVVEVVPAD
FT                   GATGVSPSAPVRVTFSEAVDPATLQGAIAVAGATGTVTVSGAVATFTPAVLVGDTTYAA
FT                   RVAAGVRSLAGGALAADHAWSFTTGANRAPVAVAGADQDVATGAPVALDASGSVDPDGA
FT                   GLEYAWTQVAGPDVTGGAGALHGPAPAFTAPAEVSTLVFDLTVRDGQSESAPDRTVVTV
FT                   LRNPAAALFVAPGGDDTAAGTRAAPLATLRVAIERLGGPGGAVPGAGVYAAAGTYFGPV
FT                   VLASGVSLYGGFDPATWLRDAAAPSVIGNSLRGVVVTGATGVVVDGFTLAAGDAISPGF
FT                   SSFGAFLVDSEVTFSRCAIAAGNGQAGAAGGAGVEGAPGNAGGAGGGGSCDGATVGAGG
FT                   AAGLGAWSGGPGGAGGAEGANAGRNGSSGGGANGGASGGGGAYGKPGQRGQDGATGGDG
FT                   FQGLNGAPGGGFGALLPLPDAYRTSDGFGGGTGGDGFGGGGGGGGGGQGPCGFLECDEG
FT                   SGNGGGGGGSGGRLGTGGGGGRGGGASLGVVVVRGAVVLRDTSVRAGNGGAGGAGGAGG
FT                   LGGPGGRGGAGGATCTGEVGGGGNGGAGGRGGDGGWGGGGGGGPSVALLNEGGAVTVEG
FT                   ASTLTPGAGGAGGAAARPGAQGVSHARWDR"
     atgcgtttcc gcaccgcgct cgccgccgcc gcgatcgccc tctccgccgc ctgctccggc        60
     tcgtccggct cctccggccc gtccggcggc ccgccacccg ccccgctcac cgtggtcgag       120
     gtggtcccgg ccgacggcgc caccggcgtc tccccgagcg cgccggtgcg cgtcacgttc       180
     tccgaggcgg tggacccggc cacgctgcag ggcgcgatcg cggtcgccgg cgcgaccggc       240
     acggtgaccg tctccggcgc ggtggcgacg ttcaccccgg cggtcctcgt cggcgacacg       300
     acctacgcgg cccgcgtggc ggcgggcgtg cggagcctgg cgggcggcgc gctcgccgcc       360
     gaccacgcgt ggtcgttcac cacgggcgcg aaccgcgcgc cggtggcggt cgccggggcc       420
     gaccaggacg tcgcgaccgg cgcgccggtg gcgctcgacg cctcgggcag cgtggatccg       480
     gacggcgccg gcctcgagta cgcctggacg caggtggccg ggccggacgt gaccggcggc       540
     gcgggcgcgc tccacgggcc ggcgccggcg ttcacagcgc cggccgaggt ctccacgctg       600
     gtgttcgacc tcacggtccg cgacggccag tcggagagcg cgccggatcg caccgtggtc       660
     accgtgctgc gcaaccccgc cgccgcgctg ttcgtcgcgc cggggggcga cgacaccgcc       720
     gccggcaccc gcgccgcccc gctcgccacg ctccgcgtcg ccatcgagcg gctgggcggg       780
     ccgggcggcg cggtgccggg cgccggcgtc tacgcggcgg ccgggaccta cttcggcccg       840
     gtcgtgctcg cgagcggcgt ctcgctgtac ggcggcttcg accccgccac ctggctgcgc       900
     gacgccgcgg cgccgagcgt catcgggaac tcgctccggg gcgtcgtcgt caccggcgcg       960
     accggcgtgg tggtggacgg cttcaccctc gccgccggcg acgccatctc cccgggcttc      1020
     agctcgttcg gcgcgttcct ggtggactcc gaggtgacgt tctcgcgctg cgccatcgcg      1080
     gccgggaacg gccaggccgg cgcggcgggc ggcgccggcg tggagggcgc gccggggaac      1140
     gccggcggcg ccggcggcgg cggctcgtgc gacggcgcca cggtgggcgc gggcggcgcg      1200
     gccgggctgg gcgcgtggtc cggcggaccc gggggagcgg gcggcgcgga gggcgcgaac      1260
     gcgggcagga acggctcgtc cggcggcggc gcgaacggcg gcgcctcggg cggaggcggc      1320
     gcgtacggca agcccggcca gcgcggccag gacggcgcca cgggcggcga cgggttccag      1380
     ggcctgaacg gcgcgcccgg cggcgggttc ggcgcgctcc tgccgctgcc cgacgcgtac      1440
     cgcacgagcg acgggttcgg cggcggcacc ggcggcgacg gcttcggcgg cggaggcggt      1500
     gggggcggcg gcgggcaggg gccctgcggg ttcctggagt gcgacgaggg ctccggcaac      1560
     ggcggcggcg gcggcggctc gggcgggcgg ctcggcaccg gcggcggagg gggccgcggg      1620
     ggcggcgcct ccctcggcgt cgtggtggtc cgcggcgcgg tggtgctgcg cgacacctcg      1680
     gtgcgcgccg ggaacggcgg ggccggcggc gccgggggtg cgggcggcct cgggggcccg      1740
     ggcggccgcg gcggggcggg cggcgccacc tgcaccggcg aggtcggcgg cggcggcaac      1800
     ggcggcgccg gggggcgcgg cggcgacggc ggctggggcg gcggcggggg cggcggcccg      1860
     agcgtcgcgc tgctgaacga ggggggcgcg gtgacggtgg agggcgcgag cacgctcacg      1920
     cccggcgccg gcggcgcggg cggcgccgca gcccggcccg gcgcgcaggg cgtcagccac      1980
     gcgcgctggg atcggtga                                                    1998
//

If you have problems or comments...

PBIL Back to PBIL home page