(data stored in ACNUC7421 zone)

EMBL: CP000251.PE589

CP000251.PE589       Location/Qualifiers
FT   CDS_pept        complement(688031..689446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0591"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region/Thioredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80367"
FT                   /db_xref="GOA:Q2INI8"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80367.1"
FT                   /translation="MRFAIRILLAALTFAAVAWIPDLIGLGPAGGSSDLRLGALLAEGS
FT                   ILAFAVAFAGGVATSLTPCVYPLIPITVSIFGARKAGSRGEAMAVSALYVLGIAAMYSA
FT                   LGVGAALTGKAFGSVMQNPWVIGFVAIVLAAMAASMFGAFELQLPPSLQARLNGVGGAG
FT                   RAGAFAMGLVSGIIAAPCTGPVLAAALTFVAAKGSVAFGFGIMFAYALGMGLLFFLIGA
FT                   FSISLPKSGAWMETVKSVFGVALLAAALIFLKDAFPALKPLFSAARGAAFAAAGAAALG
FT                   VLAGALSGSFHAPARQRLAKGLGVALLVGGIAYAAGAAGARERARAHAGFAWIHSEEEA
FT                   LALAKAEGRPVIIDFWADWCTACKELDKIAWAKPEVQEEAARFVAVKLDGTDGSDAFNA
FT                   LAEKYGVVGMPTVIFIDPRGREVPDRVMGAISAGEMVQKLRAVDGACEGKPPPATPAAV
FT                   QGEQVAMACAARW"
     atgcgcttcg ccatccgcat cctcctcgcc gccctcacct tcgccgccgt ggcgtggatt        60
     ccagacctga tcggtctcgg acccgctggg gggtcgagcg atctgcgcct cggcgcgctc       120
     ctggcggaag ggtcgatcct ggcgttcgcg gtcgcgttcg ccggcggggt ggcgaccagc       180
     ctcacaccgt gcgtgtaccc cctcatcccc atcaccgtct cgatcttcgg cgcccgcaag       240
     gcgggctcgc gcggcgaggc gatggcggtc tcggcgctct acgtgctcgg catcgccgcc       300
     atgtactccg ccctcggggt gggggcggcg ctcaccggca aggcgttcgg cagcgtgatg       360
     cagaacccgt gggtgatcgg gttcgtggcg atcgtgctcg ccgccatggc cgcctcgatg       420
     ttcggcgcct tcgagctgca gctcccgccc tcgctgcagg cgcgcctcaa cggcgtgggc       480
     ggcgcggggc gcgccggcgc cttcgcgatg gggctcgtct ccgggatcat cgccgccccc       540
     tgcaccgggc cggtgctcgc cgccgcgctc accttcgtgg cggccaaggg ctcggtcgcg       600
     ttcggcttcg gcatcatgtt cgcgtacgcg ctcggcatgg ggctgctgtt cttcctcatc       660
     ggcgcgttct ccatctcgct ccccaagagc ggggcgtgga tggagacggt gaagtcggtg       720
     ttcggcgtgg cgctgctcgc ggccgcgctg atcttcctga aggacgcgtt ccccgcgctg       780
     aagccgctgt tctcggcggc acgcggcgcg gcgttcgcgg cggccggcgc cgcggcgctc       840
     ggcgtgctgg cgggcgcgct ctccgggagc ttccacgcgc cggcgcgcca gcggctcgcg       900
     aaggggctcg gggtcgcgct gctggtgggc gggatcgcct acgcggccgg cgcggccggc       960
     gcccgcgagc gggcgcgcgc gcacgccggc tttgcctgga tccactccga ggaggaggcg      1020
     ctcgcgctcg cgaaggccga gggccggccg gtcatcatcg acttctgggc cgactggtgc      1080
     accgcctgca aggagctcga caagatcgcc tgggcgaagc ccgaggtgca ggaggaggcc      1140
     gcccggttcg tggcggtgaa gctcgacggc accgacggct ccgacgcgtt caacgcgctc      1200
     gccgagaagt acggcgtggt gggcatgccc accgtcatct tcatcgaccc gcgcggccgc      1260
     gaggtgccgg accgcgtgat gggcgcgatc tccgccggcg agatggtgca gaagctccgc      1320
     gcggtggacg gcgcctgcga gggcaagccg ccgccggcga cgcccgcggc ggtgcagggc      1380
     gagcaggtcg cgatggcctg cgccgcgcgc tggtag                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page