(data stored in ACNUC7421 zone)

EMBL: CP000251.PE59

CP000251.PE59        Location/Qualifiers
FT   CDS_pept        complement(74302..74766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0059"
FT                   /product="protein of unknown function DUF589"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79837"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79837.1"
FT                   /translation="MPRLTSPRMAYWLLKTEPGTYAWSDLVADGTTPWTGVANPQAQAN
FT                   LRAMKAGDRAIVYHSGEKRAVGIAEVVRTAYPDPTAGGELVCVDVKAVEPLPAPVPLEA
FT                   LKLEPAFEGSVLLRQGRLSVVPLAPAEWRDLAALADVIARTGGLRRKARF"
     atgccacgcc taacgtcccc gcgcatggcc tactggctgc tgaagaccga gcccggcacc        60
     tacgcgtggt ccgacctcgt cgccgatggg accaccccgt ggaccggcgt cgccaacccg       120
     caggcccagg cgaacctccg ggccatgaag gcgggcgatc gcgcgatcgt ctaccactcc       180
     ggcgagaagc gcgcggtggg gatcgccgag gtggtgcgga ccgcctaccc cgacccgacc       240
     gccggcggcg agctggtctg cgtggacgtg aaggcggtcg agccgctccc ggcgcccgtg       300
     ccgctcgagg cgctgaagct ggagcccgcg ttcgagggct cggtcctgct caggcagggc       360
     aggctgtcgg tggtgccgct cgcgccggcg gagtggcgcg acctcgccgc gctcgccgac       420
     gtcatcgccc gcaccggcgg gctgcggcgc aaggcgcggt tctga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page