(data stored in ACNUC7421 zone)

EMBL: CP000251.PE60

CP000251.PE60        Location/Qualifiers
FT   CDS_pept        74838..75278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0060"
FT                   /product="sec-independent translocation protein
FT                   mttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79838"
FT                   /db_xref="GOA:Q2IM07"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79838.1"
FT                   /translation="MFGLSFGEIVIIAVLALILLGPDRLPEAAKTIGKGLRQFKQATDD
FT                   LKDQIETEIYKDDRKVARPSLVPPVPNRPVPGPAGPPPAATAENVPGLEAALVDAEPAA
FT                   SAVEPAAAAAQPAAVATAPAPSPSPEPSGEGAPPPGTGGTAA"
     atgttcggtc tgtccttcgg cgagatcgtg atcatcgccg tcctcgccct catcctgctc        60
     gggccggatc gcctcccgga ggcggcgaag accatcggca agggcctgcg ccagttcaag       120
     caggccacgg acgatctgaa ggaccagatc gagaccgaga tctacaagga cgaccggaag       180
     gttgcgcgcc cctcgctggt gccgcccgtc ccgaaccgcc cggtccccgg tccggccggc       240
     ccgccccccg ccgccaccgc cgagaacgtc cccgggctgg aggcggcgct ggtggacgcc       300
     gagccggccg cgtccgcggt cgagcccgcc gctgccgccg cccagcccgc cgcggtcgcc       360
     accgcgccgg ccccgtcccc gtcgcccgag ccgtccggcg agggcgcccc gccgcccggc       420
     accggcggca ccgccgcgta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page