(data stored in ACNUC7421 zone)

EMBL: CP000251.PE61

CP000251.PE61        Location/Qualifiers
FT   CDS_pept        75285..76097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0061"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79839"
FT                   /db_xref="GOA:Q2IM06"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79839.1"
FT                   /translation="MSETVPQLPPPPPPSPSPEPEGEVKLSFLDHLRDLRVRMVRAMLG
FT                   IAIGMGLVGGFVPQIVDHLMKPVRDALPAGRQQLVYTSAIEPMMVYIKVAMYGGVFVAA
FT                   PWVLWQLWLFIAPGLYKREKKVVFPFLFWGTLLFYLGAVFCFELVMPQAFPAMLAFAES
FT                   DTLSPMLSLSEQLSLVLAMLLGFGVVFEVPVVIAFLSMIGLVQWRTLAKYRRIAIIVNV
FT                   IAAAIITPTGDPLNLALMAVPMIVFYEVGIVLARILGKKPAPDAAPAA"
     atgagcgaaa ccgtcccgca gctgccgccg ccgccgccgc cgtcgccgtc ccccgagccc        60
     gagggcgagg tgaagctctc gttcctcgac cacctgcgcg acctgcgcgt ccgcatggtg       120
     cgcgcgatgc tcggcatcgc gatcgggatg ggcctcgtcg gcgggttcgt gccccagatc       180
     gtggatcacc tgatgaagcc ggtgcgcgac gcgctcccgg ccggccgcca gcagctcgtg       240
     tacacgagcg cgatcgagcc gatgatggtc tacatcaagg tggccatgta cggcggcgtc       300
     ttcgtcgcgg ccccctgggt gctgtggcag ctgtggctgt tcatcgcgcc cggcctctac       360
     aagcgcgaga agaaggtcgt cttcccgttc ctgttctggg ggacgctgct cttctacctg       420
     ggcgcggtgt tctgcttcga gctcgtgatg ccgcaggcgt tcccggccat gctggcgttc       480
     gccgagagcg acacgctctc gccgatgctc tccctctcgg agcagctctc gctcgtgctc       540
     gccatgctgc tcggcttcgg ggtggtgttc gaggtcccgg tggtcatcgc gttcctgtcg       600
     atgatcggcc tggtgcagtg gcgcacgctc gcgaagtacc ggcgcatcgc catcatcgtg       660
     aacgtgatcg cggccgcgat catcacgccc accggcgacc cgctcaacct cgccctgatg       720
     gccgtgccga tgatcgtctt ctacgaggtg ggcatcgtgc tggcccggat cctcggcaag       780
     aagcccgcgc ccgacgccgc ccccgcggcc tag                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page