(data stored in ACNUC7421 zone)

EMBL: CP000251.PE63

CP000251.PE63        Location/Qualifiers
FT   CDS_pept        77662..77859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79841"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79841.1"
FT                   /translation="MTSFTGVKVFSTTLARDRDAMGETITRWLAGNPELEVVSHEVRQS
FT                   SDKEFHCLTITLFYRERKKG"
     atgacgagct tcaccggcgt gaaggtcttc tcgacgacgc tggcgcgcga tcgcgacgcc        60
     atgggcgaga cgatcacgcg ctggctcgcc ggcaaccccg agctcgaggt ggtgagccac       120
     gaggtccggc agagctcgga caaggagttc cactgcctca ccatcaccct cttctaccgg       180
     gagaggaaga agggctag                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page