(data stored in ACNUC7421 zone)

EMBL: CP000251.PE65

CP000251.PE65        Location/Qualifiers
FT   CDS_pept        complement(78632..81706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79843"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79843.1"
FT                   /translation="MPDPRSALKEFRQLDRKRLSEGLTAEEERRHAELRDLVEPELQAG
FT                   PGSGFDVGAAAERLRASLEPAGLRRAPAEAPPEPPAAEAGPEPLFEDVAPDAGLADAFE
FT                   GQPFEALEVDAPEAPAWDAAEQPAAPAAAEGWDPNAQPYDPNAAQAWDPNAQPYDPNAP
FT                   QAWDPNAQPYDPNAAQAWDPNAQPYDPNAAQAWDPNAQPYDPNAPQAWDPNAQPYDPNA
FT                   PQAWDPNAQPYDPNAAQAWDPNAQPYDPNAPQAWDPNAQPYDPSAAQAWDPNAQPYDPS
FT                   AAQAWDPNAQPYDPNAPQAWDPNAPAYDADAAQPAWNPDATATFGAPEPPPPVESPRSD
FT                   AAPADEAWTTPADEPETVDLATEAMIEELEPLSADAMALEGDPSAELPAPLAGGDAAAL
FT                   PPDGWEVTAPPPPAPEGAVLGEYDEAGAAPVALSPEGLGAEPAPEPLPPGAPPELGEYD
FT                   DTSGFAAPPEEGALELATAGAEPAAEAGWAEEVALDQGFELESGGSFDAAAEATVPEWA
FT                   REAELPPWDAPPADAGDAGGLDLAGELPVEPAPEPLAVPEEMGAAGEDGEPLALEPTLD
FT                   LGAPVDPTLELAELAEPAAGAGIAAGEDPFALREPDPEPAGGRDLSALDFAAGELGEDA
FT                   DAWAAAEAPTEAPAPFTLGDVGPQAEPLAGPEPEAELPAWDAGAAPALELEPSRWGAGM
FT                   ADVERDVADAPIEAADPSALLAEAAEALPPLELDGPAAPAPDAVAEAAPDAAASLAGAL
FT                   LDAGAEPPPAIDDLLGAEVSSQDASVEPAELADLADLAELAAVPPPDADDLPTLDGEDI
FT                   LEEIPADELVPLPPDEVAGDVEPGAPPLAEAAVAAPVPEPAPGPEDAGVPAPAPAAAAS
FT                   IPAPDLEPLPVEEVSFTPPPVVEAAPPPPGGWEVPGAHRVVIHTLEGLVRRGVIEDAAL
FT                   DAPALDLVAQGPLPERIPTDKVKAIFFMLAPGEAAPAAEGKRVRVTFRDGRQVAGFSPD
FT                   YREDGPGFFMVPADTRTSTARIWIYRSAVRQVAVS"
     atgcccgatc cgcgcagcgc actgaaggag ttccgccagc tcgaccggaa gcgcctctcc        60
     gaggggctga ccgccgagga ggagcggcgg cacgccgagc tgcgcgacct ggtcgagccc       120
     gagctgcagg ccgggccggg ttcgggcttc gacgtcggcg ccgcggccga gcggcttcgg       180
     gcgtcgctcg agccggccgg gctccgccgc gcgcccgccg aggcgccgcc ggagccgccc       240
     gccgccgagg ccgggccgga gccgctcttc gaggacgtcg cccccgacgc cgggctggcg       300
     gacgcgttcg agggccagcc gttcgaggcg ctggaggtgg acgcgccgga ggcgccggcg       360
     tgggatgccg ccgagcagcc cgccgcgcct gcggcggcgg agggctggga tccgaacgcc       420
     cagccgtacg atcccaacgc cgcgcaggcc tgggatccca acgcgcagcc gtacgacccg       480
     aacgccccgc aggcctggga tccgaacgcg cagccatacg atcccaacgc cgcgcaggcc       540
     tgggatccga acgcgcagcc gtacgatccg aacgccgcgc aggcctggga tccgaacgcg       600
     cagccgtacg accccaacgc cccgcaggcc tgggatccga acgcgcagcc gtacgacccc       660
     aacgccccgc aggcctggga tccgaacgcg cagccgtacg accccaacgc cgcgcaggcc       720
     tgggatccca acgcgcagcc gtacgacccg aacgccccgc aggcctggga tccgaacgcg       780
     cagccgtacg accccagcgc cgcgcaggcc tgggacccca acgcgcagcc ctacgacccc       840
     agcgccgcgc aggcctggga tccgaacgcg cagccgtacg accccaacgc cccgcaggcc       900
     tgggatccga acgcgccggc ctacgacgcg gacgccgcgc agccggcgtg gaacccggac       960
     gccaccgcca cgttcggcgc ccccgagccg ccgccgcccg tcgagtcgcc gcggtcggac      1020
     gccgctcccg cggacgaggc gtggaccacg ccggccgacg agccggagac cgtggacctc      1080
     gccaccgagg cgatgatcga ggagctggag ccgctctcgg cggacgcgat ggcgctcgag      1140
     ggggatccct ccgccgagct ccccgcgccg ctcgccggcg gcgacgccgc cgcgctgccg      1200
     cccgacggct gggaggtgac cgcgccgccg ccgcccgcgc ccgagggtgc cgtcctgggc      1260
     gagtacgacg aggccggcgc cgccccggtg gcgctctcgc cggagggcct cggcgccgag      1320
     ccggcgccgg agccgctccc gcccggcgcc ccgccggagc tcggcgagta cgacgacacg      1380
     agcggcttcg ccgcgccgcc ggaggagggc gcgctcgagc tcgcgaccgc cggcgcggag      1440
     ccggcggcag aggccggctg ggcggaggag gtggcgctcg accaggggtt cgagctcgag      1500
     tcgggcggct cgttcgacgc cgccgccgag gccaccgtgc ccgagtgggc gagggaggcc      1560
     gagttgccgc cctgggacgc gccgcccgcg gacgcgggcg atgccggggg cctggacctc      1620
     gccggcgagc tgccggtgga gcccgcgccc gagccgctcg cggtccccga ggagatgggc      1680
     gcggcgggcg aggacggcga gccgctcgcg ctcgagccga cgctcgacct cggcgcgccg      1740
     gtcgatccca cgctcgagct ggccgagctg gcggagccgg cggccggcgc cgggatcgcg      1800
     gccggcgagg atcccttcgc gctccgcgag ccggacccgg agccggccgg cggccgcgac      1860
     ctctccgcgc tcgacttcgc cgcgggcgag ctgggcgagg acgccgacgc gtgggccgcg      1920
     gcggaggcgc cgacggaggc gcccgcgcca ttcacgctgg gtgacgtcgg cccgcaggcg      1980
     gagccgctcg ccgggcccga gccggaggcg gagctcccgg cgtgggacgc cggcgcggcg      2040
     cccgcgctcg agctggagcc gtcccggtgg ggcgcgggca tggccgacgt cgagcgcgac      2100
     gtcgccgacg cgccgatcga ggccgccgac ccctcggcgc tcctggccga ggccgcggag      2160
     gcgctgccgc cgctcgagct ggacgggccg gccgcgccgg cgcccgacgc cgtggcggag      2220
     gccgcgcccg acgccgcggc gtcgctcgcc ggcgcgctgc tcgatgccgg cgccgagccg      2280
     ccgcccgcca tcgacgacct gctcggcgca gaggtgtcct cccaggacgc cagcgtcgag      2340
     cctgccgagc tcgccgacct cgccgacctc gccgagctgg ccgcggtgcc gccgccggac      2400
     gcggacgacc tgcccacgct cgacggcgag gacatcctcg aggagatccc ggcggacgag      2460
     ctggtgccgc tgccgcccga cgaggtcgcc ggcgacgtcg agcccggcgc gccgccgctc      2520
     gcggaggcgg cggtcgcggc gccggtgccc gagccggccc ccgggccgga ggacgccggc      2580
     gtgccggcgc cggcgcctgc cgcggccgca tcgatccccg ccccggacct cgagccgctg      2640
     ccggtcgagg aggtctcgtt cacgccgccg ccggtggtcg aggcggcgcc cccgccgccc      2700
     ggcgggtggg aggtgcccgg cgcgcaccgg gtggtgatcc acacgctcga ggggctggtg      2760
     aggcgcggcg tgatcgagga cgcggcgctg gacgcgcccg cgctggacct cgtcgcgcag      2820
     gggccgctcc ccgagcggat ccccaccgac aaggtgaagg cgatcttctt catgctggcg      2880
     ccgggcgagg ccgcgccggc ggcggagggg aagcgcgtgc gcgtcacgtt ccgcgacggc      2940
     cggcaggtgg ccgggttcag ccccgactac cgcgaggacg ggcccggctt cttcatggtc      3000
     ccggcggaca cgcgcaccag caccgcgcgg atctggatct accgctcggc ggtgcggcag      3060
     gtggcggtga gctga                                                       3075
//

If you have problems or comments...

PBIL Back to PBIL home page