(data stored in ACNUC7421 zone)

EMBL: CP000251.PE67

CP000251.PE67        Location/Qualifiers
FT   CDS_pept        83841..84452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79845"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79845.1"
FT                   /translation="MPQTRPILAAALLSLGIAQAARAADPAPAPAKPAATPAPAAKPSP
FT                   TAMDLARTLATQETWKRGMDGLTQSVVGQFRGHPGSELSMPKDFQAKARTEIEALLPYE
FT                   ELVNIHARQLSAAYGEAEMKDLLAFYKSPLGQKTLKAMPEVQEKVAVETQQRIEPKLPQ
FT                   VMQKLAKDVKPPAGGAKAPSNPHGAAPAKAAPAKPAQPKK"
     atgccccaga cccgccccat cctcgccgcc gccctcctgt ccctcgggat cgcccaggcc        60
     gcccgcgccg cggatcccgc gccggccccg gccaagcccg ccgccacgcc cgcccccgcc       120
     gcgaagccgt cgcccaccgc gatggacctg gcgcgcacgc tcgccacgca ggagacgtgg       180
     aagcgcggga tggacgggct cacgcagtcc gtcgtcggcc agttccgcgg ccaccccggc       240
     tccgagctga gcatgccgaa ggacttccag gcgaaggcgc gcaccgagat cgaggcgctg       300
     ctcccgtacg aggagctggt gaacatccac gcccgccagc tctcggccgc gtacggcgag       360
     gccgagatga aggacctgct cgcgttctac aagtcgccgc tcgggcagaa gacgctgaag       420
     gccatgcccg aggtgcagga gaaggtggcg gtggagacgc agcagcggat cgagccgaag       480
     ctgccgcagg tcatgcagaa gctcgcgaag gacgtgaagc cgcccgcggg cggcgcgaag       540
     gcgccctcga acccgcacgg cgccgcgccg gccaaggccg cgcccgcgaa gccggcgcag       600
     cccaagaagt ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page