(data stored in ACNUC7421 zone)

EMBL: CP000251.PE68

CP000251.PE68        Location/Qualifiers
FT   CDS_pept        84535..85278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0068"
FT                   /product="Lipolytic enzyme, G-D-S-L"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79846"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79846.1"
FT                   /translation="MTPPPPLRAGRLVRPAVALAVFLAAGAAPRAAPAPLVYVALGDST
FT                   AAGQGGGPGGGYPPRLARRLEGAGLAVKLVNLGVPGATAADLRRDQLPRALEAGPGLVT
FT                   VGIGINDLVQGRPLRDFARDLEVVADFLRHTRAVVVISSLPDLGDSPSAEGAPAALLRR
FT                   LDQYNAAIARVAERHGFLVADAFGETRRTVKRLGPAAVFAGDGFHPSAAGYDAWAEALW
FT                   GPVERALGARLQGRRPPAPAAAGRP"
     gtgaccccgc cgccccccct ccgcgccggg cgcctcgtgc gcccggcggt cgcgctcgcc        60
     gtgttcctcg ccgccggcgc cgccccccgt gccgcgccgg ccccgctcgt ctacgtcgcg       120
     ctcggcgact ccaccgccgc cgggcagggc ggcggcccgg gcggcggcta cccgccgcgc       180
     ctggcccgcc ggctcgaggg ggcggggctc gcggtgaagc tcgtgaacct gggcgtcccg       240
     ggcgcgaccg ccgccgacct gcgccgcgat cagctcccgc gcgccctcga ggcgggcccc       300
     ggcctcgtca cggtcggcat cgggatcaac gacctcgtgc aggggcggcc gctccgcgac       360
     ttcgcgcgcg acctcgaggt ggtggcggac ttcctccggc acacgcgcgc cgtggtggtg       420
     atctccagcc tgcccgacct gggcgactcg ccgtcggccg agggcgcgcc cgcggcgctc       480
     ctgcgccggc tcgaccagta caacgccgcc atcgcgcggg tggcggagcg gcacgggttc       540
     ctggtggcgg acgcgttcgg cgagacgcga cggaccgtga agcggctcgg ccccgcggcg       600
     gtgttcgccg gcgacggctt ccacccgtcg gcggccggct acgacgcctg ggccgaggcg       660
     ctgtgggggc cggtggagcg ggcgctcggc gcgcggctgc agggccgccg gcctcccgcg       720
     ccggccgcgg ccgggcggcc gtga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page