(data stored in ACNUC7421 zone)

EMBL: CP000251.PE7

CP000251.PE7         Location/Qualifiers
FT   CDS_pept        8483..9259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79785.1"
FT                   /translation="MSCGACCGLYNAEDLSRPSLHAELARRTRVLREVERTPAAFHAAA
FT                   AALAVGGPAPLFPSVRVCPLLGFLDEAESRVGCLAHPAANGGVDLRDCGVYDVATCDAF
FT                   LCPSHAWLSEEEAAIAAAACDDYHLYGLVITDVEFVRAALAGVAVRAGARVELRHLEHP
FT                   PFRAALRELFALKEELAPGSDGLFGAFRPGADGEPVARRIDYEALGRTGGSPHDRILTC
FT                   VGADPRSGNDLEALEAEVRRRLDACAEVFGGTRPPG"
     atgagctgcg gcgcgtgctg cggcctgtac aacgccgagg acctctcccg cccctcgctc        60
     cacgccgagc tcgcgcggcg cacccgggtc ctccgcgagg tcgagcgcac cccggccgcg       120
     ttccacgccg ccgcggccgc gctcgccgtc ggcgggcccg cgccgctctt cccgtcggtg       180
     cgcgtctgcc cgctgctcgg cttcctcgac gaggccgagt cgcgcgtcgg gtgcctggcg       240
     cacccggccg cgaacggcgg cgtggacctg cgcgactgcg gcgtctacga cgtcgccacc       300
     tgcgacgcgt tcctctgccc gagccacgcc tggctctcgg aggaggaggc ggccatcgcc       360
     gcggccgcgt gcgacgacta ccacctgtac ggcctcgtca tcaccgacgt cgagttcgtc       420
     cgggcggcgc tcgccggggt ggcggtccgc gccggcgcgc gggtcgagct gcgccacctc       480
     gagcacccgc cgttccgcgc cgcgctccgc gagctcttcg cgctgaagga ggagctcgcg       540
     cccggctccg acggcctgtt cggcgcgttc cggccggggg ccgacggcga gccggtggcg       600
     cggcgcatcg actacgaggc gctcggacgc accggcggct cgccccacga ccggatcctc       660
     acctgcgtgg gcgcggaccc gcgctccggc aacgacctcg aggcgctcga ggccgaggtg       720
     cgccgacggc tcgacgcctg cgcggaggtg ttcgggggga cgcgtccccc cggctag          777
//

If you have problems or comments...

PBIL Back to PBIL home page