(data stored in ACNUC7421 zone)

EMBL: CP000251.PE71

CP000251.PE71        Location/Qualifiers
FT   CDS_pept        87409..87681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79849"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79849.1"
FT                   /translation="MPNVVDLTLVSRARRALHAVLEERGLGFFLAAGSRTPRLDPRRIA
FT                   WVVEVARRQVSLRARRDPDALSRTRRVLRRELIRRLTEAMLQAGL"
     gtgccgaacg tcgtcgacct cacgctcgtc tctcgcgcgc gccgcgcgct gcacgccgtg        60
     ctcgaggagc gcggcctcgg gttcttcctc gccgcgggct cccgcacgcc gcgcctcgac       120
     ccgcgccgca tcgcctgggt ggtggaggtg gcgcgccgcc aggtctcgct ccgcgcgcgc       180
     cgcgatcccg acgcgctctc gcgcacccgc cgcgtgctgc gccgcgagct gatccgccgg       240
     ctcaccgagg cgatgctgca ggcggggctg tag                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page