(data stored in ACNUC7421 zone)
EMBL: CP000251.PE74
CP000251.PE74 Location/Qualifiers
FT CDS_pept complement(89573..89812)
FT /codon_start=1
FT /transl_table=11
FT /locus_tag="Adeh_0074"
FT /product="hypothetical protein"
FT /db_xref="EnsemblGenomes-Gn:Adeh_0074"
FT /db_xref="EnsemblGenomes-Tr:ABC79852"
FT /db_xref="UniProtKB/TrEMBL:Q2IM18"
FT /inference="non-experimental evidence, no additional
FT details recorded"
FT /protein_id="ABC79852.1"
FT /translation="MADPFENKLVDKRVVQRYLRKGKVDEKEYEKLQKALPDLADQAMP
FT IEASMSGVEEPDDLDDDEPEEDVGGGEVPPQQQP"
atggccgacc cgttcgagaa caagctcgtc gacaagcgcg tggtgcagcg ttacctgcgc 60
aagggcaagg tggacgagaa ggagtacgag aagctccaga aggcgctccc cgacctcgcc 120
gaccaggcga tgcccatcga ggcgtcgatg agcggcgtcg aggagccgga cgatctcgac 180
gacgacgagc ccgaggagga cgtcggaggt ggtgaggtcc cgccgcagca gcagccgtag 240
//
If you have problems or comments...
Back to PBIL home page