(data stored in ACNUC7421 zone)

EMBL: CP000251.PE78

CP000251.PE78        Location/Qualifiers
FT   CDS_pept        92462..93172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79856"
FT                   /db_xref="GOA:Q2IM22"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79856.1"
FT                   /translation="MMRGARQLRFRLSPPRSHGGRRPGAGRKPSGARAGVSHHGRPSVT
FT                   ASSPVHVTLRVLPHVWNLRSQRALRVVEAAFEAATAARSTFRVVHFALEGNHLHLIAEA
FT                   DGSRALSSGMQGLCIRLAKGLNRMMGRRGKVFADRYHARVLGTPTEVRTALAYVLLNHR
FT                   SHLARMGKPLGRGGVDRFSSGGWFDGWRGGGAGAAVREAARSITAAPRSWLLSTGWRRR
FT                   GLLSCDEVPRALGG"
     atgatgcgcg gcgctcgtca gctccggttc cggctctccc ctcctcgcag ccacggcggc        60
     cgtcggcccg gcgcggggcg caagccctcg ggcgcgcggg cgggggtctc gcaccacggg       120
     cggccttcgg tcaccgcctc ttcgccggtg cacgtcacct tgcgtgtgct cccgcacgtc       180
     tggaacctgc ggagccagcg cgcgctccgg gtcgtcgagg cggcgttcga ggccgccacg       240
     gcggctcgca gcaccttccg cgtggtccac ttcgcgctcg aggggaacca cctccacctc       300
     atcgcggagg cggacgggtc gcgggcgctc tcctcgggga tgcaggggct gtgcatccgg       360
     ctcgcgaagg ggctcaaccg catgatgggg cggcgcggca aggtcttcgc ggaccgctac       420
     cacgcgcgcg tgctgggcac gcccaccgag gtccgcaccg cgctcgccta cgtgctgctc       480
     aaccaccgga gccacctcgc gcgcatggga aagcctctcg ggcgcggggg cgtggaccgg       540
     ttctcctccg gcggctggtt cgacgggtgg cgcggcggtg gggctggggc tgcggtgcgg       600
     gaggctgcgc ggagcatcac ggcggcgccg cgctcctggc tgctctccac ggggtggagg       660
     cgccgggggc tgctctcgtg cgacgaggtt ccgcgggcgc tcggggggtg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page