(data stored in ACNUC7421 zone)

EMBL: CP000251.PE8

CP000251.PE8         Location/Qualifiers
FT   CDS_pept        complement(9256..11391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79786"
FT                   /db_xref="GOA:Q2ILV2"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79786.1"
FT                   /translation="MNPALTSAMLVVAAAVFTFTMTRRVMPLLALRRDVRTDRPGERLR
FT                   ALVRYGLGQRRLVDPEERRPGLLHVVIFAAFLVLALRTVTMFGMGFSAGFHLPLLAPDS
FT                   GLGRAYGLVKDVMVLLALVAVLGFLWRRLVTRPDRVTRSTEGVVILFFIAGLMITDVLF
FT                   DGALHVLREDPLGLGDLLAGAGFQLPAPRFDWLAPAGSLGAALYHGIGASAGTVSAVGE
FT                   ASFWLHLALILVFGNVLPYGKHFHIITGLPNVFFARLPPAGALRKLDLEAEDASYGTAT
FT                   VKDLSWKEAWDVYSCTECGRCQTHCPTYVTGKPLSHKEVNRSIRHHLAEVAPALTALAR
FT                   AKDPAVREAAAGALPPISEVIPPETFWACTTCGWCETACPVLIENVPRLVDMRRQAVQV
FT                   DSVFPDEAQRVFKGIETQGNPWGIGSNKRTEWCEDLDVPRAADGGDHEWLFFVGCAGAF
FT                   DDRQKKVSRAIVRILREAKVSFAILGEEETCTGDAARRLGNEYLFQMQATALTETLNGH
FT                   GVKKILVQCPHCLNTIANELPQFGGRYEVVHHADLIARLVKDGRLAPGVAEGLGQVTFH
FT                   DPCYLARWNGVTEAPREALAAAGVQVAEMPRNRRQGFCCGAGGGRFWLEEKLGARVNQN
FT                   RVEEAAATLGKAGGVIATGCPFCLTMMKDGVNETGREETLRVLDVAEIVALGLPKRAES
FT                   APAAAPESTPAAPRGEA"
     atgaatccag ccctcaccag cgcgatgctc gtcgtcgcgg ccgcggtctt caccttcacg        60
     atgacccgcc gcgtcatgcc gcttctcgcg ctgcggcggg acgtgcgcac cgaccggccg       120
     ggggagcgac tccgggccct cgtccgctac ggcctcggcc agcggcgcct cgtcgatccc       180
     gaggagcgcc gcccgggcct gctccacgtc gtcatcttcg cggcgttcct ggtcctcgcg       240
     ctccgcaccg tcacgatgtt cggcatgggc ttctcggcgg gcttccacct gccgctgctc       300
     gcgccggact ccggcctcgg ccgcgcctac gggctcgtga aggacgtgat ggtgctgctc       360
     gcgctcgtcg cggtgctggg cttcctgtgg cggaggctcg tcacgcggcc ggaccgggtc       420
     acgcgctcga ccgagggcgt ggtgatcctc ttcttcatcg ccggcctgat gatcacggac       480
     gtcctgttcg acggcgcgct gcacgtgctg cgcgaggacc cgctcggcct cggcgacctg       540
     ctcgccggcg ccggcttcca gctccccgcg ccccgcttcg actggctcgc gccggccggc       600
     tcgctcggcg ccgcgctcta ccacgggatc ggcgcgtcgg cgggcacggt gagcgcggtg       660
     ggcgaggcgt cgttctggct ccacctcgcg ctcatcctcg tcttcggcaa cgtgctgccc       720
     tacggcaagc acttccacat catcaccggc ctgccgaacg tgttcttcgc gcggctcccg       780
     ccggcgggcg cgctccgcaa gctcgacctc gaggcggagg acgcgagcta cggcaccgcc       840
     accgtgaagg acctgtcgtg gaaggaggcc tgggacgtct acagctgcac cgagtgcggc       900
     cgctgccaga cccactgccc cacctacgtc accggcaagc cgctcagcca caaggaggtg       960
     aaccggtcga tccgccacca cctcgccgag gtggcgccgg cgctcaccgc gctggcgcgc      1020
     gcgaaggacc ccgcggtccg cgaggcggcg gcgggcgcgc tcccgcccat ctccgaggtg      1080
     atcccgccgg agacgttctg ggcctgcacc acctgcggct ggtgcgagac cgcctgcccg      1140
     gtcctcatcg agaacgtgcc gcgcctggtg gacatgcgcc ggcaggcggt gcaggtggac      1200
     tcggtcttcc ccgacgaggc gcagcgcgtg ttcaagggga tcgagacgca gggcaacccc      1260
     tggggcatcg gctcgaacaa gcgcaccgag tggtgcgagg acctggacgt gccgcgcgcc      1320
     gccgacggcg gcgaccacga gtggctgttc ttcgtgggct gcgccggcgc gttcgacgac      1380
     cggcagaaga aggtctcgcg cgccatcgtg cggatcctgc gcgaggcgaa ggtgtccttc      1440
     gcgatcctgg gcgaggagga gacctgcacc ggcgacgcgg cccggcggct cggcaacgag      1500
     tacctgttcc agatgcaggc caccgcgctc accgagacgc tgaacggcca cggggtgaag      1560
     aagatcctgg tgcagtgccc gcactgcctc aacaccatcg cgaacgagct gccgcagttc      1620
     ggcggccgct acgaggtggt gcaccacgcc gacctcatcg cgcgcctggt gaaggacggg      1680
     cggctcgcgc ccggggtggc ggaggggctc ggccaggtga cgttccacga tccctgctac      1740
     ctggcgcgat ggaacggcgt caccgaggcg ccgcgcgaag cgctcgccgc ggcgggcgtg      1800
     caggtggcgg agatgccgcg aaaccgccgg cagggcttct gctgcggcgc cggcggcggc      1860
     cgcttctggc tggaggagaa gctcggcgcc cgcgtgaacc agaaccgggt ggaggaggcc      1920
     gccgcgacgc tcggcaaggc gggcggcgtc atcgccaccg gctgcccgtt ctgcctcacc      1980
     atgatgaagg acggcgtgaa cgagaccggc cgcgaggaga cgctgcgggt gctggacgtc      2040
     gccgagatcg tggcgctcgg gctgccgaag cgcgccgagt ccgcgcccgc cgcggcgccc      2100
     gagagcaccc cggccgcgcc gcggggcgag gcctag                                2136
//

If you have problems or comments...

PBIL Back to PBIL home page